KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3673
Entry
YP_3673           CDS       T00165                                 

Gene name
clpB2
Definition
(GenBank) putative Clp ATPase
  KO
K11907  type VI secretion system protein VasG
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YP_3673 (clpB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_3673 (clpB2)
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_3673 (clpB2)
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_16 AAA_5 Clp_N AAA_22 Sigma54_activat Zeta_toxin AAA_7 NACHT ResIII T2SSE ClpB_D2-small Torsin AAA_30 AAA_18 Lipase_chap TniB DUF87 AAA_25 RuvB_N DUF815 RsgA_GTPase ATPase_2 TrwB_AAD_bind IstB_IS21 Muted SseB_C FlxA
Other DBs
NCBI-ProteinID: AAS63821
UniProt: A0A0H2W9K7
Position
complement(4183297..4185900)
AA seq 867 aa
MGAITVYQRERLFNRLGTFAYKTFVEATRLCRSYRHEYVELEHWLKILMDQQRGDIPALL
THYGLSQTVISTQLDRIIQHMPVTKASVQDLSSRLESVVEGGLVLSQLMASPSPIRTSHI
LLALLQDTQHQRWLYRLCDEFKKLPVPQVAEEYEGLLVNSIEQTSEVQRGDALVTETDSS
SSKEAHAALNKWCNDLTQQARDGEIDPVIGREAELRQVIDILLRRRQNNPILVGEAGVGK
TAVVEALARKLASGDVPPLLQGARLLSLDLGRMQAGASMRGEFESRLKSLIDGISQSDTP
VILFCDEAHTLVGAGGQAGTGDAVNLLKPMLARGALRMIAATTWSEYKQFIEPDAALTRR
FQRVLIGEPNESTAVDMLRAIAPHFAQHHNVTIRDGAIHAAVRLSLRNLPSRQLPDKAIS
LLDTACARVALSQYAQPQAIEQLSAQLDVLKTEHQYLVREKQLGEAVDQRLDDVQTQIQA
FEHELTALQSRHLHEQQLVREVLPEGEGSGMMTENARWGELMALQEASPLVYPWVDEQSI
AAVLSDWTGIPSGKMLQDDIECVLNLEQRLGDHIFGQRNAIKEISQAIRIARAGIQSQER
PLGIFLLAGSTGTGKTETANVLVETLYGGAHNLITFNMSEFQEAHTLSTLKGAPPGYVGY
GKGGKLTEAVRRKPYSVILLDEFDKAHADIQDAFYQVFDKGWMEDAEGRRVSFRQCFILL
TCNQGAEEIEQAYLTANDIKPGALKPLVYDALLRRFAPALLARVNIIPYIPLDQDALAQI
ASHHLARLQTRLWDEIGATLVTEGDIPGWIASRVCSHPNHGRAVEELLRQTLLPAVGNEV
LKRRHEAEPLREIRLIVEETELSIEFA
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgggagcgataacggtgtatcaacgcgaacgtctttttaatcgattgggcacttttgcc
tataaaacttttgttgaagccacccgtctttgccgcagttatcggcatgagtatgtggag
cttgaacattggttaaaaattctcatggatcaacagcgtggggatattcctgctctactg
acgcattacggactgagccagacggttatctccacgcaattggatcgcattattcagcat
atgcccgtcaccaaagcatcggtgcaggatttatcatcacgcttggagtccgtggtcgaa
ggcggattggtgttgagccaattgatggcgtcaccttctcctatccgtacctcgcatatt
ttactggcactattacaggatacccagcatcagcgctggttataccgcctgtgcgatgaa
ttcaaaaagctgccggtcccacaggttgcagaggaatatgaaggcctattagttaactcc
attgaacagaccagcgaggttcaaagaggcgacgcattagtgacggaaacggacagcagc
tcatcaaaagaagcgcatgcggcattgaacaaatggtgtaacgaccttacccagcaagcc
cgtgacggtgagattgaccccgttattggtcgtgaagcagaactgcgtcaagtgattgat
attttactccgtcgccgtcagaacaaccctattttggttggggaagcgggggtcggtaaa
acggcggtggttgaagcgctagcgcgaaaactggccagtggcgatgtccctccgctgttg
caaggggcgcgtctgctttctctggatttggggaggatgcaagccggtgccagtatgcgc
ggtgaatttgaatcacgtcttaaatccctgatcgatggcatcagccaatcggataccccg
gttattctgttttgtgatgaagcccatacgttggtgggggcaggcgggcaggcgggcacg
ggggatgcggtcaacctgcttaaaccgatgttggcgaggggcgcattgcgcatgatcgcc
gccaccacctggtcagagtataaacagtttattgaacctgacgccgcgctgacccggcgt
ttccagcgggtattgattggcgagccaaacgaatctaccgccgtcgatatgctacgggcg
attgcgccacattttgctcaacatcataacgtcactatccgcgacggtgccattcacgcg
gcggtgcgcctgtcattacgcaacctgccttcccggcagttgcccgataaagccatcagt
ctgctcgacaccgcttgcgcgcgggtcgcgctcagccaatatgcccaaccacaggcgatt
gaacagttatcggcccaactggatgtgctcaaaaccgagcatcaatatctggtacgggag
aagcaactgggcgaagcggttgatcaacggctagatgacgttcagacacagatccaggcg
tttgaacatgaactaaccgccttgcaaagccgccatctgcatgagcaacagctagtgagg
gaggtcctgccggagggagaaggcagtggcatgatgacggaaaatgcccgctggggtgaa
ctgatggcgttacaggaagcgtcgccactggtctatccatgggttgatgagcagagcatc
gccgcggtgctttccgattggaccgggatcccgtccggcaaaatgttgcaggacgatatt
gaatgcgtcctgaatcttgaacagcgtctcggtgatcatattttcgggcaacgcaacgct
atcaaagagatttcgcaggcgatacgtattgctcgggcgggcatccagtctcaggagcgg
ccactcgggatcttcctgctggcggggtcaaccggtacgggcaaaacagaaacggccaat
gtactggtcgaaaccttgtatggcggtgctcataaccttattaccttcaatatgagtgag
ttccaagaggcgcataccttatccacgctgaaaggcgcacctccgggctatgtcggctat
ggcaagggggggaaattaaccgaagcggtaagacgcaaaccttattcggtcatcctgctt
gatgagtttgataaagctcacgccgatattcaggacgccttttatcaggtcttcgacaaa
gggtggatggaagatgccgaagggcgtcgggtcagtttccgccagtgtttcatcttactg
acctgtaatcagggcgcggaagagatcgaacaggcttacctcaccgccaacgatatcaaa
cccggtgcattaaaaccgttggtatacgacgccctgttgcgccgctttgcgccagcgctg
ttagccagggtcaatatcattccttatatcccattagatcaggacgctctggcacagatc
gcctctcatcatcttgcgcgcttacaaacgcgcctgtgggatgaaattggtgccactttg
gtgaccgagggggatatccccggctggatcgcctcacgggtttgcagccatccgaaccat
ggtcgtgcggtggaagaactcttgcgtcaaaccttacttcccgctgttggcaatgaagtg
ttgaagcgtcgccatgaggctgaaccgctgagagagatacgcctgattgttgaggagaca
gaactgagtattgagttcgcgtag

DBGET integrated database retrieval system