KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3676
Entry
YP_3676           CDS       T00165                                 

Definition
(GenBank) hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_3676
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_3676
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AAS63824
UniProt: A0A5P8YL33
Position
complement(4188756..4189199)
AA seq 147 aa
MDISAPILFDKLSLRHEHVRLPHWREVIVRDIESLLNDSAHSARLKLKKYPHCEASVLNY
GLPSLSQQVPVITDLLELARHIQRIIATFESRLDPRSIKVVPLINKGETWVLAILFDIHA
RCNLPGEEHLVNLRIALDYSYGMVRVL
NT seq 444 nt   +upstreamnt  +downstreamnt
atggatatttcagcaccgatactttttgacaaattaagtctccgccatgaacacgttcgc
ttacctcattggcgtgaagtgattgtgcgcgatattgaatctttattgaatgactccgca
cacagtgcccggttgaagctaaaaaagtatccgcattgtgaggcttctgtattgaattac
gggctgccttcgctcagtcagcaggtaccggtaatcaccgacttgctggaactggccaga
catatacagcggatcatcgccacgtttgagtcacgcctggatccgcgctcaataaaagtg
gtgccgctgattaataaaggcgaaacctgggtgttagccatcctgtttgacattcatgcc
cggtgcaacctaccgggcgaagagcacttggtcaatttacgcatcgcgctcgattactcc
tatggaatggttcgcgttctttaa

DBGET integrated database retrieval system