KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3677
Entry
YP_3677           CDS       T00165                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YP_3677
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_3677
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_3677
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AAS63825
UniProt: Q0WJG3
Position
complement(4189273..4189791)
AA seq 172 aa
MAALVDYFLHIEGVDGESPDQQYNGWIQVQAWQWAEENAGRWGLGGGGGSGKVEMKDFEF
RMVSNKASPKLFLMCAIGEHIPQAKLVCRKSGQGQQDFLIVTFSNCLVSSFKTVGNMPLG
KGDAVFTDTVLPTDAISLNFARIEVEYKEQQPDGSMGAVIKAGYDLKLNSRI
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcagctttagtcgattactttctccatatcgaaggtgtagatggtgagtctcccgat
cagcagtataacggatggatccaagtacaggcttggcaatgggcggaggagaatgcgggg
cgctgggggctaggtggcggtggtggttctgggaaagtcgaaatgaaggacttcgaattt
cgcatggtgagtaacaaagcatcaccaaaactatttttgatgtgtgccatcggtgaacac
attccgcaggccaagttggtgtgtcgtaaatcaggtcaaggtcaacaagacttcctgatt
gttaccttcagtaactgtctggtgtcctcctttaaaactgtcggcaacatgcctcttggt
aaaggggacgcagtattcaccgacacggtgctgccaacggatgccatcagccttaacttt
gcacgtatcgaagtggaatacaaagagcagcaacctgatggctcgatgggggccgtgatt
aaggctggttacgatctgaaattgaacagccgtatttaa

DBGET integrated database retrieval system