KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3678
Entry
YP_3678           CDS       T00165                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_3678
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_3678
SSDB
Motif
Pfam: VipB VipB_2 DUF3386
Other DBs
NCBI-ProteinID: AAS63826
UniProt: Q0WJG4
Position
complement(4189954..4191465)
AA seq 503 aa
MENMQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRRAIGTLAAYANKGQVK
VNRDVVLTIESLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLSYLVDNTDANETLKIRV
LNISQDELGKTLRRYRGSAWDQSPIFKQVYEHEYGQFGGEPFGCMIGDYEFDHSPQSVAL
LTELAKVAAAAHCPFITSSSPSIMQMNNWRELGNPRDIGKIFTTPEYAPWRRLRESNDSR
YLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDFTWANAAYAMGVNINRAFNEYG
WCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTELAISDRRENELSNAGFLPLVYRKN
SDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFATCRFAHYLKCIVRDKIGSFRSR
DDMQLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQVEDVEDDPGFYRAHFYLRPHYQ
LEGMTVSLRLVSKLPSNKESEKK
NT seq 1512 nt   +upstreamnt  +downstreamnt
gtggagaacatgcagaaagcccaactcaatgacacgccagacatcaacgtcgatctggct
gaaaacgagttagatgacattttaaaacgttcttttcgccctcgaactgacgaagcttcc
gccacagtgcgccgtgccataggcacgcttgctgcgtatgccaataaaggccaagtgaaa
gtcaatcgtgatgtcgtactgaccattgagtctttagtcgctgaaattgacgaaaaactt
tccgatcaaatgaaccttattctgcaccataaagagttccaaaagctggaatcagcttgg
cgcgggcttagctatcttgttgataatacagatgctaatgaaactttaaaaatacgggta
ctgaacattagccaagatgaactggggaaaacgcttcgccgttatcgtggctctgcatgg
gatcaaagtccgatatttaaacaggtctatgaacatgaatatgggcagtttggtggggaa
ccttttggttgcatgatcggtgattatgaattcgatcacagtccacagagtgtggctctg
ctgaccgagttagccaaggtggccgccgccgctcactgtcctttcattacctcttcttcc
ccaagcatcatgcagatgaataactggagggagctgggtaacccaagggatatcggcaaa
atctttaccacacctgaatatgcgccatggagacgtttacgtgagagtaatgactcccgc
tatctggtactgactctgccacgttttctttcgcgtctgccgtatggtgccaaaaatcat
cctattgatgattttgcttttgaagaagtggttagccctcatgccagtgaggatttcacc
tgggcgaatgcggcctatgccatgggcgtcaatattaaccgggccttcaatgaatatggt
tggtgttcaaggatccgcggtattgagtcgggggggtccgtagaagaacttccggcctat
gcttttccttctgacgaaggcggatatgaactcacttgtccgacagaattggcaatttcg
gaccgtcgtgagaacgagctatccaatgctgggtttttaccgctggtctaccgtaagaac
tcagactttgccgcctttatcgggtcgtgcaccctgcatgcaccggcaaactatgatgac
cccgatgcgacggcgaacgccagattatcggcccgtttaccttacatttttgccacctgt
cgtttcgcccattacctcaaatgtattgtgcgcgacaaaattggttcgttccgctcgcgg
gatgacatgcaactttggcttaacgactgggtgatgaactacgtcgatggtgacccctcc
atttcaacagaagccactaaagctaaacgcccgctggccgctgcggaagttcaagttgaa
gacgtagaggatgatcctggtttttaccgcgctcacttctatttacgccctcactaccaa
cttgaaggtatgacggtttctctgcggctggtttctaaacttccatccaacaaggaaagc
gaaaagaaataa

DBGET integrated database retrieval system