KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3679
Entry
YP_3679           CDS       T00165                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_3679
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_3679
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AAS63827
UniProt: A0A2U2H085
Position
complement(4191465..4192025)
AA seq 186 aa
MAKDASSQKFIGRNNAPRVQIEYDVEIYGSNKKVELPFVTGVMADLSGHRAKPLPAVEDR
KFLTFDQDNFDARMRAIKPRLKFYVDNTLSEDNELLDIELDFESMDDFSPGSLARRIPQM
EKLLEARTHLAELITYMDGKTSAEEVVKQLLEQPDFLQNLATDAQGTISKLSQDDDVLVE
DDDGEK
NT seq 561 nt   +upstreamnt  +downstreamnt
atggccaaagatgcgagctcgcaaaaatttatcggtagaaataatgcacctagagtgcaa
attgaatatgacgtcgaaatttatggttcaaataagaaagtagagttgccttttgtaacc
ggcgtgatggctgatctttctggccacagagcaaagcctcttcctgctgttgaagatcgt
aaattccttactttcgatcaggataatttcgatgcccggatgagagcaattaagcctcgc
cttaaattctacgtagataacaccttgagtgaggataacgaactcctggatatcgaactg
gattttgagtcaatggatgacttttcccccggatcgttagcgcggcgtattcctcaaatg
gaaaaactgcttgaggcacgcacccatctggctgaattgatcacctatatggatggtaaa
accagcgcagaagaggtggttaaacaactgcttgaacaacctgattttttacaaaatctt
gcgaccgatgcacagggaactatttcgaagctcagccaggatgatgatgttttagtggaa
gatgacgatggagaaaaatag

DBGET integrated database retrieval system