KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3944
Entry
YP_3944           CDS       T00165                                 

Gene name
vgrG7
Definition
(GenBank) putative Rhs accessory genetic element
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YP_3944 (vgrG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_3944 (vgrG7)
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_3944 (vgrG7)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Ribosomal_L5e
Other DBs
NCBI-ProteinID: AAS64088
UniProt: A0A5P8YKX7
Position
complement(4486328..4488730)
AA seq 800 aa
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQA
AEVAKTALDAKAKVLDGGVTPTNIVATGPAPTVSGAQMTEMAGGIGDAVGGTAGKRINQA
AEVAKTALEAKAKVLDGGVTPMNLAAGGAGAGLPDSAAAAISRLVKQPSGLQFTLTTASL
PPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGM
VASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVEEIITTLLKENGINDFAFG
FRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDVGSLPKGASLP
YNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAW
QLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGP
PGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDF
LHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFRSKTHKGEGYNEMRFEDAKGGEGLFM
HAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTVVRNQSNTIQNDRRVEVTRDQQTEVGN
DYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQGDISISTPNAGITITHDGAI
VLQGKYIRLAADMIDLNPEE
NT seq 2403 nt   +upstreamnt  +downstreamnt
atgtttgctcatgataaagctaataataataaagccgcggacaagaccggcacggtgacg
ccgacccatatcgtctcgccggaggccgccccaaccgtgagtggcgctcagatgaccgag
atggccggggggattggggatgcggtgggcggcactgccggtaagcgcatcaatcaggcc
gccgaggtggcaaaaaccgccctggatgccaaagcaaaagtactggacggcggcgtcacg
ccgacgaacattgtggccactggcccggccccaaccgtgagtggcgctcaaatgaccgag
atggccggggggatcggggatgcggtgggcggtactgccggtaagcgcattaatcaggcc
gccgaggtggctaaaaccgccctggaggccaaagcaaaagtactggacggcggcgtcacg
ccgatgaatctggccgcgggcggggccggtgcgggattgccggacagcgccgcggcggcg
atatcccgcctggtcaaacagccctccggcctgcaatttaccctgacgacggccagttta
ccgccccagacctttgcggtggtggatttcaccctgagcgagatgctctcctcgccgttt
gtgctcaatgtcgggctggcgagtgccgatccggcggtggattttgcggcggtattggat
gaagacgccacgctgtttatctggcgcgaaggggtactgcaacgcagcatcaccggcatg
gtcgccagctttgaacagggcgataccggttttcatcagacccgctacagcatggtgatc
cgcccggcgctgtggcgcaccagcctgcggcgcaatgcccgcatcttccagcaagcctcg
gtggaagagatcatcaccaccctgctgaaagagaacggcatcaacgattttgcttttggt
tttcgccacccgcacccggtgcgcgagttctgcgtgcaatatcaggagtccgattttgat
tttatccagcgcctgacggcagaagaggggattttctactacttcgagttcagcgccggg
aaaaataccgtggtgtatgccgatgatgttggctccctgccgaaaggcgcgtcactgccc
tataacccgaatgtggcggcgcaggcgcaggaactgagtatcaccaccttcacccgcagt
gcgcaggtgcgcccggcgatggtgcaactgaaagactacacctttaaaaacccgaactgg
gccgcggccttcagcgaacagtcgggagaactgcaaaaccagcgaccggactacgagcat
tttgattttccggggcgcttcaaagatgcccagcacgggcaggattttacccgctaccgg
ctggacgcgctgcgcaatgacgccaatctggggcagggggccagcaatgattttaccctc
cagccggggcagttgttcagcctgtacaaccacccgcgtggtgatctgaaccacgcctgg
cagttgctcggtattcagcacagcggcaaacagatgcaggcgctggagcaggcatctggc
gatcagggcacggtgctgttcaaccacttcagttttattccgcacacccagacctggcgg
ccgacgccgttggctaaaccggcgatggacggcccgcagatcgccatggtggtggggccg
ccgggggaagagatttactgcgacgaatacggccgcatccgcctgcaatttttatgggat
cgctacgggcagagcaatgacaacagctcctgttggatccgggtaacccagccgtgggcg
ggccagggctggggcatgctggccattccgcgtattggtcaggaagtggtggtggatttt
ctgcacggcgatccggatcaaccgattgtcacggggcggacctatcacgccaacaacatc
ccgccggggtcgttaccggccagtaaaacccagatggcgttccgctcaaaaacccacaaa
ggggaaggctacaacgaaatgcgcttcgaggatgccaaaggcggcgaagggctgtttatg
catgcgcagaaagatatgacgaccatggtgctgaatgatcgcaaaaccgatgtgactcag
gaccattcagagcacattgggcaagatcagtccgtgacggttgtgcgtaaccaaagtaat
acgatccaaaatgatcgccgggtagaggtgactcgcgatcaacaaaccgaagtgggcaat
gattaccagctagtggtgaaaggtgaaaagaaagagtttgtgacgaaaattcgttacacc
gaagtgcatgaagacgaaacgctcacggtgacgaaaagtattaaaatccatgccaaacaa
ggtgatatcagcatatcaaccccgaatgccggaattacgatcacccatgacggtgccatt
gttctgcaagggaaatacattcgtttagcggccgatatgatcgatcttaatccagaggag
tag

DBGET integrated database retrieval system