KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3947
Entry
YP_3947           CDS       T00165                                 

Gene name
icmF4
Definition
(GenBank) putative exported protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YP_3947 (icmF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_3947 (icmF4)
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_3947 (icmF4)
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C MMR_HSR1
Other DBs
NCBI-ProteinID: AAS64091
UniProt: A0A5P8YKZ0
Position
complement(4490189..4493722)
AA seq 1177 aa
MKLPFFIRIAKPAIPRLKASIPVVLALMACAALIWVWIYGPEWQLGENYPFETLLSRWLV
TAVFVLVAVCWLSLKVMRRVQHLEKLQLQTKIQLDDPVSADIEQQNHYLNGWKHQLQRHL
NTPEYLYRLPWYMVIGARNSGKSTLIKEGYKLTEISASERLHAEDAADLRVRCWLGEQAV
IIDPAGVLIEQPTTPIAGKASLNSRLWQSLLSWLIEQRQRQPLNGIILTVDLHQMMTANK
AQRETYVADIHQRLQEIRLSLHSQVPLYVVFTKMDLLYGFEAMYQSLDKAEREAVLGVTF
SLNAADPDVWRTELKQFWQQWVAQLNGAMPDMMLNSVDAGQRSQLFSFTRQMQGLHDYVV
QLLEGILYRGEHAQPLLRGVYLTSAQQRGQMDDIFTQSAAVQYHLAPQAFPTWPVSDTTP
YFTKALFNQVLLAEPNLAGENGIWLQKTRKRMFIFSGVGALAALTLWGYWHYYHQLNYRA
GEEVLTQAKTFLSIPPPEGDDRYGNLQLPLLNPIRDATLAYGNYHERSPFLADMGLYQGN
NIGPYVESTYLQLLQQRFVPALMSGLLEQLNAAPKGSEEKLEILRVMRMLEDGSGRNAAL
VEQYMSHRWSQQFNGQRELQEQLSSHLNYALKHTDWHGARESGDQYAIKSFVPYLRPIQS
AQQELSKLSIYQRVYQNLRIKAQDALPPALDLRDQIGASFDDIFVSGNDRLLVIPQFLTR
SGLQSYFIKQNDQLVDLTVMDSWVLNLTKNVEYSEADRKEIHRQVTEQYLGDYTATWRAA
MNNLSVSDFEGLPQAISAIEQVISGEQPFRRALQTLSDNTRLPVISDLIPAKEQQELLQK
PDYLLLTRINREFSPETAVLVENGDKGSVIQSVYQKLTELHRYLLAIQNSPAPGKAALKA
VQLRLDQNNSDPIFEVQQLAKNLPEPLNRWVGELAEQAWRVVMMEAIQSLEVEWNETVIK
QYQTYLAGRYPFDPHAKQDVPLSEFERFFGPKGTLDAFYQQNLKPFVENNLTGGSDGELL
IRPDVLQQLAQARKIRDTFFSAQNGLGTQFAIEPVLLSGNKRRSVLNLDGQLLDYAHGRS
GVVHLVWPNSMRAGVESKLTLVPDESGKSPRTLSFSGPWAQLRLINAGELTNVGTNSFDV
RFKVDGGEMTYRIFVDESDNPFAGGLFSKFSLPDTLY
NT seq 3534 nt   +upstreamnt  +downstreamnt
atgaaattgccgttctttatacgcatagccaagcccgccattcctcgccttaaagcgtca
ataccggtggtattggcgttgatggcttgtgcggcactcatttgggtatggatttacgga
cccgagtggcaattgggggaaaattacccgtttgagacattattgagccgttggttggtc
acggcggtatttgtcttggtggccgtttgttggctcagcctgaaagtcatgaggcgagta
caacacctggaaaaactccaactgcaaacgaaaattcagctcgacgaccccgtcagtgct
gatatcgagcaacaaaaccactacctcaatggctggaagcaccaacttcagcgccatttg
aacaccccggaatatctgtatcgcctgccctggtacatggtcattggtgcgcgcaatagc
ggcaaaagtacactgatcaaagaagggtataaactgacagagatctccgcatccgagcgg
ctccatgcggaagacgcagcagatctgcgcgtccgctgctggttgggggaacaagcggtt
attatcgatcctgcgggggtgctgattgaacaacctacgacaccgatcgcgggcaaagca
tcactcaacagccgcttatggcaaagtctattatcctggctgattgaacagcgccagcgt
cagccgctaaacggcattattctcaccgtcgatcttcatcagatgatgaccgcgaataaa
gcgcagcgggagacttacgtcgctgatattcatcaacggctgcaagagatacggctgtct
ttgcacagccaggtgccgctgtatgtggtgttcaccaaaatggacctgctgtacggcttc
gaggccatgtaccaatcgctggataaagccgaacgtgaagcggttctgggggtgacgttc
agcctcaatgcggcggatccggacgtgtggcggacggagttgaaacagttctggcagcaa
tgggtcgcacaactgaatggcgcgatgccggacatgatgctgaacagtgtggatgccggg
cagcgtagccagttgtttagcttcactcgccagatgcagggcctgcacgattacgtcgtg
caactgctggaaggcattctgtaccgtggagaacatgcccagccgctgttacggggggtt
tatctcacgtctgcccagcaacgcgggcaaatggacgatatctttacccaatctgccgcg
gtgcaatatcaccttgcgccacaggccttcccgacctggccggtctcggatacgacgccg
tattttaccaaagcgctgtttaaccaggtgctattggccgaacccaatctggccggagag
aacggtatctggctgcaaaaaacgagaaagcgaatgttcattttctcgggggtgggtgcc
ctggccgcgctgaccttatggggctactggcactactatcaccagcttaactaccgggct
ggcgaagaggtattaacccaggcaaaaaccttcttatcgatcccaccgccagaaggcgat
gaccgttatggcaatctgcaactgccgctgctaaaccccatccgtgacgccacgctggct
tacggtaattaccatgaacgcagcccgttcctggcggatatggggttatatcagggcaat
aatatcgggccttatgtcgaaagcacttacttgcaactcctacagcaacgttttgtcccg
gcactgatgagcgggctgttagaacaactgaacgccgcgccgaagggcagtgaagagaaa
ctggaaattctgcgggtgatgcggatgttggaagacggcagtggccgcaatgccgcgctg
gttgaacaatatatgagccaccgctggagccaacaattcaacggccagcgcgagttgcag
gagcaactgtcgagccacctgaactacgcactgaaacacaccgactggcacggcgcacgg
gaaagtggcgatcaatatgcgatcaagagctttgttccgtacctccgcccgatccagtca
gcgcagcaagagttgagcaaactctcgatctaccaacgggtgtatcagaacctgcggatc
aaagcacaggatgcgttgccgcccgcgctcgatttgcgcgatcagatcggcgcaagtttt
gacgacatctttgtctccggtaacgatcgcctgctggtgatcccgcaattcctgacccgt
agcggcttacagagttacttcatcaaacagaacgatcaactggttgatctcacggtgatg
gacagttgggtacttaatctcaccaagaacgtcgaatacagcgaggcagaccgcaaagag
atccatcgccaggtgaccgaacagtatcttggcgattataccgccacctggcgtgcggct
atgaataacctgtcggtcagtgattttgaaggcttgccacaggcgatcagcgccattgaa
caggtgatcagcggggaacaacctttccgccgtgcactgcaaacgctgagtgacaacacc
cgcttgccggttatctcggatctgatccccgcgaaggagcagcaagagctgctgcaaaaa
cccgattacctgctgctgacccgcatcaaccgtgagttctcccccgaaacggcggtgctg
gtggagaatggcgataaaggcagcgtgatccaaagtgtttaccaaaaactgaccgagcta
caccgctatctgttggcgatccaaaactcgcccgcgccgggcaaagcggcgttgaaggcg
gtgcaattacgtctggatcaaaacaacagtgatccgatttttgaagtccagcaactggct
aaaaacctgccggagccgctaaaccgttgggtgggcgaactggcagagcaagcctggcgg
gtggtgatgatggaggcgatccagtcactggaagtggagtggaatgagacggtgatcaaa
cagtatcaaacctacctggccggacgttatcccttcgatcctcacgcgaaacaggatgta
ccactcagtgagtttgaacgcttcttcgggccgaaaggcacgctcgatgcattctatcag
cagaacctgaaaccgtttgtcgaaaacaacctgaccggtggcagcgatggcgaattgctg
atccggcctgatgtgttacagcaactggcgcaggcacggaaaattcgcgacaccttcttc
tcggcccaaaacggcctgggcacacagtttgcgattgaaccggtgctgttaagtggcaac
aagcgccgcagcgtattgaatctggatgggcaattactggattacgcccatggccgcagc
ggcgtagtgcatctggtttggccaaactcgatgcgtgcaggagtggaaagcaaactgacg
ttagtcccggatgagagcggcaaatcaccgcgcaccctcagcttcagcggtccttgggcg
cagttgcggctgatcaacgccggtgaactgaccaatgtgggcaccaactccttcgatgtc
cgcttcaaggttgatggcggcgagatgacgtaccgcatctttgttgatgaatccgacaac
ccattcgcgggcggtttgttcagtaaattcagtctgccagacactctgtattga

DBGET integrated database retrieval system