KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3952
Entry
YP_3952           CDS       T00165                                 

Definition
(GenBank) putative membrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YP_3952
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_3952
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_3952
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AAS64096
UniProt: A0A6B3T811
Position
complement(4499239..4500006)
AA seq 255 aa
MKTDAVTDNTPFPAAEAVTSHRQYQLPLRGESLNAMIDTATPLLGMVLRLKDMENQALPD
QLYQQVVTDIRAIEQYLQTKGYEPGAIISFRYVLCTFIDETALGHGWNTQNGWLQQSLLV
HFHNETWGGEKVYVLLERLMGEPKRYQDLLEFIYLCFCLGYRGRYKVTSQNGDDFERLFR
RLHHQLQQLRGDAPPTVLYQGGGRLNSRYHLSKRLTIKHLLWGGVSLLVVIYLFYAIHLH
TQSQDILQQLNNLLS
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaaaacagatgctgtgactgacaacacccctttccccgcagcggaagcggtcacctcc
catcggcagtatcagctaccgctacgtggcgaaagcttgaacgcgatgatcgataccgcc
accccattattggggatggtactgcgcctgaaagacatggaaaaccaagcgttaccggac
cagctatatcagcaggtggtgacggatatccgtgctattgagcagtacttgcaaaccaaa
ggctacgaacccggcgcaatcatatctttccgatatgtgctgtgcacattcatcgatgaa
acggcattagggcatggctggaacacccaaaacggttggttacagcaatctctgttggtg
cattttcataatgaaacctggggcggagagaaagtgtacgtcctgctggaacgcttaatg
ggggaacccaagcgttaccaagacctgctggagtttatctatctctgtttttgtttgggt
taccgcggccgctacaaagtgacatcacaaaacggtgatgactttgagcgattgttccgc
cgattgcatcatcaattacagcagttacggggtgatgcgccgccgacggtcctttatcaa
gggggcggtcgtctgaatagccgctaccacttgagtaaacggttgactatcaagcatttg
ttatggggtggcgtgagtctgctggtggtgatttatctgttttatgccatccacctgcac
acccaaagtcaggatattttgcaacagctaaacaatttattgagctag

DBGET integrated database retrieval system