KEGG   Yersinia pestis 91001 (biovar Microtus): YP_pCRY16
Entry
YP_pCRY16         CDS       T00165                                 

Gene name
virB11
Definition
(GenBank) type IV secretory pathway VirB11 component
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YP_pCRY16 (virB11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_pCRY16 (virB11)
Enzymes [BR:ypm01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     YP_pCRY16 (virB11)
Secretion system [BR:ypm02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   YP_pCRY16 (virB11)
SSDB
Motif
Pfam: T2SSE AAA_7 ABC_tran MetallophosN
Other DBs
NCBI-ProteinID: AAS58621
UniProt: A0A0H2VZA7
Position
pCRY:12494..13519
AA seq 341 aa
MTAKNISLDRYKQRFFGDFLELPGLTEIAVNRPGELYTKINGVWEQHAVPLSYEDCYNFA
RCLAKHHGDNIEDIKPGLSATLESGERCQVIVPPACERDTVSITIRKPSKVQIPHQSYID
AGFYNRVTGEEKTETHDEELIALYNTKNIPLFMEKCVEYGKTLAVAGETSTGKTTYMKML
IGYIPVHLRISTIEDNPEITFFIHKNYVHLFYPSESSDEKGSIVTPASLLRWNYRMNPDR
ILLTEVRGAEAWDFLKITGSGHEGSMTSIHAGSAKEAIDGFITRCYENPQCAQLPYTFML
RKVLDSLDVIVSIDLDGNVRRMNDIYFRPIHRNQYFEEMKA
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccgctaagaatatttccctcgaccgctataaacagcgtttctttggcgactttctg
gagcttcccggcctgacggagatcgccgtcaaccgtccaggtgagctgtataccaaaatc
aacggcgtatgggagcagcacgccgttcctttgtcctatgaggattgctacaactttgcc
cggtgcctggcaaagcaccacggcgacaatatcgaagatattaagccggggctgtcagcc
acgctggaatctggcgaacggtgccaggtgattgttcccccggcctgtgagcgcgatacg
gtgtctatcaccatccgtaagccatcaaaggtacaaatcccgcatcagtcgtatatcgat
gcgggattttataaccgggtaacaggcgaggaaaaaacggagacgcacgacgaggaatta
attgcattgtacaatacaaaaaatattcctctgtttatggagaaatgcgtcgagtacggt
aaaactctcgcggtcgccggggaaacaagtaccgggaaaaccacctatatgaaaatgttg
atagggtatattcctgtacatcttcggatatcaaccattgaggacaacccggaaatcacg
ttctttatccataaaaactacgtccatcttttttatccgtcagaatcatcagatgaaaaa
ggttctatcgttaccccagcgagccttttacgctggaattaccgtatgaaccctgaccgc
attttattaacggaggttcgcggtgcggaagcctgggacttccttaaaataacaggttcc
ggccatgaagggagtatgacctccattcatgcaggatcagcgaaagaagctatagatggg
tttattacccgttgctatgaaaatccacagtgcgcccagctcccctatacatttatgtta
cgtaaggttctggatagcctggacgtgattgtgagcattgatttagacggaaatgtccgc
cgtatgaatgacatctatttccgtccaattcatcgaaaccagtattttgaggaaatgaaa
gcatga

DBGET integrated database retrieval system