KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_1599
Entry
YPN_1599          CDS       T00370                                 
Name
(GenBank) phage tail assembly protein
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
SSDB
Motif
Pfam: Lambda_tail_I
Other DBs
NCBI-ProteinID: ABG17929
UniProt: A0A0H2YHL0
Position
1804920..1805540
AA seq 206 aa
MTLFAQEVMTPIKLSGSLAKMFGRDHQRLVGSSGEVIKALCVTIPGFEQYLMTAKQRGLT
FAVFKNKRNVGKDELELASGGQEIRIVPVIIGSKRGGLFQTILGVALIGMATFMSGGLAV
AFGAGGVWGGAMAMMGASMALGGVIQMLSPQQSGLAMRQSPDNKPSYAFGGPVNSTAQGN
PVGVLYGKRRIGGAVISAGIYAEDQM
NT seq 621 nt   +upstreamnt  +downstreamnt
atgactttatttgcgcaagaagtaatgacaccaatcaaactaagcggttcattagctaag
atgttcggtcgcgaccatcaacgattagttggtagctctggcgaagttattaaggcttta
tgcgtaactattcctggctttgagcaatacctgatgacggctaagcagcgtggactcacg
tttgctgtattcaaaaataagagaaatgtcggcaaggatgagttggagcttgcaagtggt
ggacaagaaattcgtattgttcctgtaattatagggagcaaacgcggtgggctgttccag
accatactcggcgtagctttaatcggtatggcaacatttatgagtggaggcttggcggtg
gcgtttggcgcgggtggagtatggggtggtgcaatggcaatgatgggcgcatccatggcc
cttggcggcgttatccaaatgctatcaccgcagcagagtgggttagccatgaggcaatca
ccagacaacaagccaagctatgcattcggcggcccggttaactctacggctcagggtaac
ccggtgggcgtactctacggcaagcgtcgaattggcggggcggttatctcggcgggtatt
tatgctgaagatcaaatgtaa

DBGET integrated database retrieval system