KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_3745
Entry
YPN_3745          CDS       T00370                                 
Name
(GenBank) transcriptional regulator, LacI family
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ypn03000]
    YPN_3745
Transcription factors [BR:ypn03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    YPN_3745
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 Peripla_BP_4 LacI HTH_Tnp_ISL3 HTH_Crp_2 HTH_3 DUF3606 HTH_24 TetR_N TrmB
Other DBs
NCBI-ProteinID: ABG20072
UniProt: A0A0H2YM34
Position
4297663..4298667
AA seq 334 aa
MTTMKDVAEMAGVSTATVSRALMNPEKVSTVTRQKVEQAVLAVGYSPHALSRNIKRNESR
TILVIVPDISDPFFADVIQGIEHAAAQQGYLILIGDCAQQTQQERTFVNLIITKQIDGML
LLGSNLPFDASKEEQRNLPPMVMANEFAPELELPTVHIDNLTAAYEAVNYLHELGHKRIA
CIAGPESLPLSHYRLQGYIQALRRNGITVDNDYIIRGDFSYEAGAQSFAALMELPHPPTA
IFSHNDVMAVGAIWQAKQLGLRIPQDVSLVGFDDLKLSQFCDPPLTTVAQPRYQIGQQAM
LLLLEQLQGHSVQSGSRLLDTELIIRESTAAPKH
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgaccacgatgaaagatgttgctgaaatggcaggtgtatcaacagcaaccgtgtctcgc
gcgttgatgaaccctgaaaaggtttcaaccgtgacccgacaaaaagtggaacaagccgtt
ttggctgttggttattctcctcatgctttatcccgtaatattaagcgtaatgaatcacgt
acgattctggtgatcgtacccgatatcagtgacccattttttgccgatgtcattcagggc
attgaacacgcagccgcccagcaaggctatctgatattaattggtgattgcgcacaacaa
acccagcaagagcgcacatttgttaatctgattatcaccaaacagatcgatggcatgctg
ctattaggctctaacctgccttttgatgccagtaaagaagagcagcgaaatttacccccg
atggtcatggcgaatgagtttgctcctgagttggagctgccgaccgtacatatcgataac
ctgaccgccgcttatgaagccgttaactatttgcatgagttgggccataaacgcatcgcc
tgtatcgccgggccagaaagcctgccgctgagccattatcggttacaaggttatattcag
gcactgcgtcgtaatggtattactgtcgataatgactatattatacgcggggatttcagc
tacgaagcgggggcccaaagctttgcggctcttatggagctgccccacccccccactgca
atattttctcacaatgatgtcatggcagtaggggctatctggcaggcgaagcaattaggg
ttacgtatcccgcaggatgtctcgctggttggctttgatgacttgaagctgtcacagttt
tgtgaccccccattaactaccgtcgcacaaccccgttaccagattggccagcaagccatg
ttactcttactggagcaactgcaagggcattcagtacaaagtggctcccgcttgttagat
accgaattaatcatcagggaaagtactgctgcgcctaaacactag

DBGET integrated database retrieval system