KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0347Help
Entry
YPN_0347          CDS       T00370                                 

Definition
(GenBank) Isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YPN_0347
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ypn01007]
    YPN_0347
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ypn03016]
    YPN_0347
Enzymes [BR:ypn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     YPN_0347
Amino acid related enzymes [BR:ypn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   YPN_0347
Transfer RNA biogenesis [BR:ypn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    YPN_0347
 Prokaryotic type
   Other AARSs
    YPN_0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g zf-FPG_IleRS tRNA-synt_1e tRNA-synt_1f tRNA-synt_1_2
Motif
Other DBs
NCBI-ProteinID: ABG16679
UniProt: Q1CMV1
Position
423938..426754
Genome map
AA seq 938 aa AA seqDB search
MSDYKNTLNLPETGFPMRGDLAKREPDMLKRWYEQDLYGIIRAAKKGKKTFILHDGPPYA
NGNIHIGHSVNKILKDIIVKSKGMAGYDSPYIPGWDCHGLPIELKVEQLIGKPGEKVSAA
EFRTACRKYAAEQVEGQKKDFIRLGVLGDWDHPYLTMDFKTEANIIRALSKIIDNGHLHK
GAKPVHWCTDCGSSLAEAEVEYYDKTSQSIDVRFNAVDTATVAAKFGVSAVNGPISLVIW
TTTPWTLPANRAISLNAEYLYQLVQVEGECLILAADLVESVMKRAGITQWAVLGSCTGSD
LELLRFTHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGPDDFVIGQKYGLEVANPVGPN
GCYLAGTYPTLDGLFVFKANDVVVELLREKGALLHVEKLLHSYPCCWRHKTPIIFRATPQ
WFISMDQKGLRKQSLQEIKGVQWIPDWGQARIETMVANRPDWCISRQRTWGVPMSLFVHK
ETEQLHPRSIELMEEVAKRVEQDGIQAWWDLDPAEILGADAADYVKVPDTLDVWFDSGST
HSSVVDVRPEFGGHSPDMYLEGSDQHRGWFMSSLMIATAMKGKAPYRQVLTHGFTVDGQG
RKMSKSIGNTISPQDVMNKLGGDILRLWVASTDYTGEIAVSDEILKRSADSYRRIRNTAR
FLLANLNGFDPAQHQVKPEEMVVVDRWAVGRAQAAQAEIMEAYENYDFHLVVQRLMQFCS
VEMGSFYLDIIKDRQYTAKGDGIARRSCQTALFHIAEALVRWMAPIMSFTADEIWNHLPG
ERQQYVFTEEWYDGLFGLAGNESMNDTFWAELLKVRGEVNKVLEQARSDKRIGGSLEAAV
TLYAEPELAARLNSLQDELRFVLLTSAAKVAAYADAGNDAQQSELIAGLKITFNKADGEK
CPRCWHYTQDVGLVAEHAELCGRCVTNVAGDGEERKFA
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactacaagaataccctgaacttgcctgaaacagggttcccgatgcgcggcgat
ctggctaagcgtgaacctgacatgctgaaacgttggtatgagcaggatttatacgggatt
attcgtgcggccaagaaaggtaaaaagacctttattttgcacgatggccccccttatgcg
aacggcaacattcatattggtcactctgttaacaaaattctcaaagatattattgttaaa
tcaaaaggaatggctggatatgattcaccgtatatccccggttgggattgtcatggtttg
cctatcgagctaaaagttgaacaattaattggtaagccgggtgagaaagtcagcgctgca
gagttccggactgcttgccgtaaatatgccgctgagcaggttgaaggccagaagaaagat
tttattcgtctgggcgtgttgggtgattgggaccatccttacctaacgatggatttcaaa
actgaagccaatattatccgcgcattaagcaaaatcattgataacggtcatctgcataaa
ggtgccaaacctgtgcattggtgtaccgattgcggttcgtcgctggctgaagcagaagtt
gaatattacgataagacgtcacaatctattgatgtgcgttttaacgcggttgatacggca
actgttgcggccaaatttggtgtatctgctgttaacggcccaatctcactggttatctgg
actaccacgccatggactctgcctgctaaccgggctatttcactgaatgccgaatatctt
taccagttggttcaggttgagggcgagtgcctgattctggcagccgatctggttgagagc
gtcatgaagcgcgcgggcattactcagtgggccgtgttgggaagttgcacaggctccgat
ctggaactgttgcgctttacccatccctttatgggctttgatgttccagccattttaggt
gaccacgttacattggatgccggtaccggtgcggttcacaccgcgccaggtcacggcccg
gatgactttgttatcggccaaaaatatggcttagaagtggcgaaccctgtcggtccaaac
ggttgctatctggcgggtacgtatccaacgctggacggcctgtttgtgtttaaagccaac
gatgtggttgtcgagttgctgcgtgagaaaggcgcactgctgcacgttgaaaaactgctc
cacagctacccatgctgctggcgtcacaaaactcctattatcttccgtgcaacgccgcag
tggtttatcagcatggatcagaaggggttgcgtaagcagtcacttcaagagatcaaaggc
gtgcaatggatcccggattggggtcaggcgcgtatcgaaaccatggtagcaaaccgccca
gactggtgtatctctcgtcagcgtacttggggtgtgccgatgtctctgttcgttcacaaa
gagaccgaacaacttcatccgcgcagtattgaactgatggaagaagtggccaaacgtgtt
gagcaagatggcattcaagcgtggtgggatctggatccggcagagattttaggtgccgat
gccgcagattatgtcaaagtgccagatacgctggacgtatggtttgactctggttccacc
cattcttcggtcgttgacgtccgccctgaatttgggggtcatagcccggatatgtatctg
gaaggttctgaccagcaccgcggctggtttatgtcttcattgatgattgctacggcgatg
aaaggtaaagcgccttaccgtcaggttctgacccacggttttactgtggatggtcagggt
cgcaaaatgtccaaatccattggtaacaccatcagcccacaagatgtcatgaacaagctg
gggggtgacattctgcgcctatgggtggcatcaaccgactataccggtgagattgctgtt
tctgatgaaattctgaaacgctctgcggactcctatcgtcgtatccgtaataccgcacgc
ttcctattagctaacctaaacggctttgatcccgcacagcatcaagtgaaaccggaagag
atggttgtagtcgatcgctgggcggttggccgtgcgcaagcggctcaggcagaaattatg
gaagcgtatgagaattacgatttccatttggtagtgcaacggctgatgcagttttgctcg
gttgagatgggatccttctatctggatatcattaaagaccgtcagtacaccgcgaaaggt
gacggcattgcacgccgtagctgccagacagcactgttccatattgccgaggcgttggtg
cgctggatggccccaatcatgtccttcactgcggatgaaatctggaatcatctgccgggc
gagcgtcaacaatatgtcttcactgaagaatggtatgacggtctgtttggtttggcgggc
aacgaaagtatgaatgatactttctgggctgaattgttgaaagtgcgcggcgaagtgaac
aaagtgttggagcaggcccgtagcgataaacgtattggtggctcattagaggccgcagtg
acgttatacgcagagcctgaactggctgctcgtttgaacagtttgcaagatgaattgcgc
tttgttctactgacttctgccgctaaagtggccgcttatgctgatgcgggcaatgatgct
cagcaaagtgaattaattgccgggttgaaaattacctttaataaggctgacggcgagaag
tgcccacgttgctggcattacacgcaagatgtcggtttggtagcagagcacgctgaactg
tgtgggcgctgtgtcactaacgttgctggtgatggtgaggagcgtaagttcgcctga

DBGET integrated database retrieval system