KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0374Help
Entry
YPN_0374          CDS       T00370                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypn02044]
    YPN_0374
Secretion system [BR:ypn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPN_0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N Inhibitor_I48
Motif
Other DBs
NCBI-ProteinID: ABG16706
UniProt: A0A0H2YFG7
Position
451919..452917
Genome map
AA seq 332 aa AA seqDB search
MDNNMSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQINWHHISEQANKL
LEQCFDLRVMLWFIRANIHIKGISALYDGFMRINAQTQDTDVVIYPQSEEPPLNSGHAAA
LGWLSTAQCIAELKTARLTEEHPYILQDLITTEALPNGQERYFVTSSTLFLTVNNYFQQN
GLPDLKDQLTKVDMLLEQIESYANQSTESYQLHCEQLRIFLKNNISQLAQLNAPEHDDPE
TVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLDRILEYFQHYEPSHPAPIFIRRTKEM
IGMDFYSIVEEILPEAVITLKQFTGKTNLPFR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacaataatatgagtgacatatttcctcaagcattattcggcgttgaatatgatccg
gcctatggcgagattgagtccatcctctctcaattagatgagtctgcggaccccctttcc
cgcccgcatgaaccccctcaaataaactggcaccatatcagtgagcaagccaataagctg
ctagagcaatgttttgatttacgtgtaatgctttggtttataagggcaaatattcatata
aaaggaatatcggccctctatgatggctttatgcgcattaatgcacaaacccaagatact
gatgttgttatctaccctcaatcggaagaaccgccattaaatagtgggcatgccgccgca
ttaggttggttatctacagcacaatgtattgcagagcttaagactgcacgccttacagaa
gagcacccttacattttacaagatcttattacgactgaagcgttacccaatggccaagag
agatattttgttacatcttcgacattatttttaactgtcaataattatttccaacagaat
ggattgccagatttaaaagaccaattgacaaaagtagatatgttgttggaacaaattgag
tcctatgcaaatcaatccacagagagttaccaactgcattgtgaacaattacgtattttc
ttaaaaaataatatttctcagcttgcacaattgaatgccccagaacatgacgatcccgaa
actgtttatcaaaaaatagacagtcatgaatctcttgatactcagtcctttaattcaaat
gataagagcattcgctcacggcaagagatcattatgatgctggaccgtattctagagtac
tttcaacattatgagcctagtcatccagccccaatattcattcgccgtaccaaagagatg
ataggtatggatttttattccattgttgaagaaattctgcctgaagctgtaattacatta
aaacagtttaccggaaaaactaacctaccgtttcgatga

DBGET integrated database retrieval system