KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_1109Help
Entry
YPN_1109          CDS       T00370                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolysing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00250  Alanine, aspartate and glutamate metabolism
ypn01100  Metabolic pathways
ypn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YPN_1109
Enzymes [BR:ypn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     YPN_1109
Peptidases [BR:ypn01002]
 Cysteine Peptidases
  Family C44
   YPN_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: ABG17439
UniProt: A0A0H2YH42
Position
complement(1273161..1274825)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLELKTDPIELRKKALEMSRLMRHRGPDWSGVWANDKAILAHERLSIVDVNTGA
QPLYNAAHTHILAVNGEIYNHQALRQQYSDRYAFQTGSDCEVILALYQEKGPAFLDDLQG
MFAFVLYDTEKDAYLIGRDHLGIIPLYMGHDEHGNMFVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIREYYHRDWFDYDHVKDNVTDKIQLANALEDAVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDNERSEAWWPQLHSFAVGLIGSPDLRAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKNFLDVAMRINPQD
KMCGNGKMEKHILRECFESYLPHSVAWRQKEQFSDGVGYSWIDTLKEKAAEQVTDQQMET
AHFRFPYNTPGSKEGYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDESFKNMDD
PSGRAVGVHQDAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggggtcttagagcttaaaaccgaccctattgaattacgcaagaaa
gcgctagaaatgtcacgtttgatgcgtcaccgtggcccagactggtctggtgtctgggcg
aatgataaagccatcctcgcccatgagcgcttatctattgttgacgtcaataccggtgcc
cagccgctgtataatgccgcccacacacatatcttggccgtgaatggtgaaatttataat
catcaagcattacgtcagcaatatagcgaccgttacgccttccaaacgggttcagactgt
gaagttattctggcgttgtatcaagaaaaagggcccgcgttcctcgatgatctgcaaggg
atgtttgccttcgtcctatacgataccgagaaagacgcctacctgatcggccgtgaccat
ttaggtattatcccgctgtatatggggcacgacgaacacggcaatatgtttgtagcttcg
gaaatgaaagccttggtacccgtttgccgcaccataaaagaattccctgctggcagctat
ttgtggagtcaggatggcgagatccgcgaatactatcatcgcgattggtttgattacgac
cacgtcaaagacaacgtaaccgacaaaatccaacttgccaacgcattggaagatgcggtt
aaaagccatctgatgtccgatgtcccttatggggtattgctgtctggtggcctggattca
tccgttatctctgctatcaccaaaaaatttgccgcccgccgtgtagaagataatgaacgc
agcgaagcctggtggccacaactgcactccttcgccgtcggtttgattggctcacccgat
ttacgcgcagcacaagaagtcgctaaccacttgggcacggtacaccatgaaattcatttc
accgtgcaggaagggctggatgccatccgcgatgtgatttatcacatcgaaacctatgat
gtgacgactatccgcgcgtcaacgccgatgtacctgatgtcacgtaaaatcaaagccatg
ggcatcaaaatggtgctatctggtgagggttctgacgaagtcttcggtgggtatctctat
ttccacaaagcgcccaacgccaaagaattacatgaagaaaccgtgcgtaaactgttagct
ctccatatgtatgactgcgcccgtgccaacaaagcgatgtcagcttggggcgttgaagct
cgtgtgcccttcctggataaaaacttccttgatgtcgccatgcgtatcaatccacaggat
aaaatgtgcggcaatggcaaaatggagaaacatatcctgcgagaatgtttcgaatcttac
ctgccacacagcgtcgcctggcgtcagaaagaacaattctctgatggtgttggctatagc
tggattgacaccttgaaagagaaagcagccgagcaagtcactgaccaacagatggaaacc
gctcacttccgcttcccgtacaacacacctggctcgaaagaagggtatttgtaccgtgaa
atctttgaagagctgttcccgctacctagtgcggcggaatgtgtccctggcggcccctct
gttgcctgttcatcagctaaagccattgaatgggatgaatcattcaaaaatatggatgat
ccatcaggccgtgcggttggcgtccatcaggatgcttacaaataa

DBGET integrated database retrieval system