KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_1442
Entry
YPN_1442          CDS       T00370                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypn02044]
    YPN_1442
Secretion system [BR:ypn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPN_1442
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABG17772
UniProt: A0A0H2YG87
Position
1641971..1642495
AA seq 174 aa
MVSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADR
KLLDIDIDNFDERMKAMKPRVAFAVLNTLTGEGQLMVDITFESMDDFSPDAIAKKVDSLS
QLLDARTQLANLQTYMDGKAGAEELVMKLLKDKSLLTTLASAPKAKQSAVDTPQ
NT seq 525 nt   +upstreamnt  +downstreamnt
atggttagcaaaagtaattctcaaaagtttatcgctcgaaaccgagcgccacgcgtgcag
attgaatacgatgtggaaatatacggtagtgaaaagaaggttgaattacctttcgttatg
ggggtattagcagatttatccggtaaacctcttgagcctttaccttcagtcgctgacaga
aaactgttagatatcgatattgataatttcgatgagcgcatgaaagcaatgaaaccacgt
gttgcattcgccgtgctgaatacattgactggggaaggccagttaatggtcgatattacg
tttgagagtatggatgatttctctcctgacgctatcgcgaaaaaagttgattcattgtct
caattattagatgcccgaactcaacttgccaacttgcagacttatatggatggtaaggct
ggtgctgaggaattagttatgaaattgctgaaagacaaatcattactgacaacgcttgca
tccgcaccgaaagcaaaacaatccgctgttgatactccacagtaa

DBGET integrated database retrieval system