KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_1719
Entry
YPN_1719          CDS       T00370                                 

Definition
(GenBank) hypothetical protein
  KO
K12532  membrane fusion protein, RTX toxin transport system
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YPN_1719
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypn02000]
    YPN_1719
   02044 Secretion system [BR:ypn02044]
    YPN_1719
Transporters [BR:ypn02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   YPN_1719
Secretion system [BR:ypn02044]
 Type I secretion system
  RTX toxin transporter
   YPN_1719
SSDB
Motif
Pfam: Biotin_lipoyl_2 HlyD_3 Biotin_lipoyl HlyD_D23 QRPTase_N
Other DBs
NCBI-ProteinID: ABG18048
UniProt: A0A0H2YHW2
Position
1935245..1936246
AA seq 333 aa
MSAFIQHIKNRWTRCFTPARTRDEYDFLPAYLEIVERPIAPLARRTAWLLILTLLLVLIW
AIIGKLDIHASASGKVIVAEHSKIIQPAEPGVVTEINVRDGDTVDAGQVLIALNPIGIDA
EVRNINQQLQYRQLEAARLVALLADEPLKNFKPPYNSPESLVVASRALLTKEYAEVTAEL
SRQDSELAVNQAHLQAGIEHNSHQKALLKNIHRRLQASRTLAKSKSIAEVELLVQEREWL
TATAEANRLQSEQDILRAKAHSLAQTRMHYLAKIDRDNRERLNKTHEIIHQLQQEQIKMM
DKQRQQTLRAPVAGVIQQLAVHTLGGWLPRRNR
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtctgcgtttattcagcacataaaaaaccgctggacgcgttgttttacccccgcgcgt
acccgtgatgaatatgattttttgcctgcttatttggaaattgtcgagcgcccgattgcc
ccattagcccgtcgtacagcgtggttactcatactgacattattgctggtattgatatgg
gcgattattggaaaacttgatatccatgcctcagccagcggcaaagtgattgttgcggaa
cattccaaaattatccaacccgcagaacctggagtggtgacggaaattaatgtccgagat
ggggataccgttgatgccgggcaggtgcttattgcattaaaccctattggcattgatgcc
gaagtacgcaatatcaatcagcaactacagtatcgtcagttagaagccgctcggttagtg
gctctcctggctgatgaaccgctaaaaaatttcaagccgccttataacagccctgaatct
ctggtggtggcatccagagcactgttaacaaaagaatatgccgaagtgacagctgaattg
tcacgtcaggatagcgaactggcggtgaatcaggcgcatcttcaggccggaattgagcac
aactctcatcaaaaagcattgctgaaaaatattcatcggcggctacaagcgtcgcgtacg
ctggctaaatctaagtcaattgccgaggtcgagcttctggtacaggagcgggaatggtta
acggcaacggctgaagccaaccgtttgcagagtgaacaagatattttacgggccaaagca
cacagtttggcgcaaacccgtatgcactatctggcgaaaatagaccgtgataatcgggag
cgattgaataaaacccacgaaattattcatcagcttcagcaagagcaaatcaaaatgatg
gataaacaacgccagcaaaccctaagagctccggtggctggcgttatccagcaattagcg
gttcataccttaggggggtggttaccacggcgcaaccgttaa

DBGET integrated database retrieval system