KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_1878Help
Entry
YPN_1878          CDS       T00370                                 

Definition
(GenBank) vitamin B12 transport protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00480  Glutathione metabolism
ypn00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    YPN_1878
  Metabolism of other amino acids
   00480 Glutathione metabolism
    YPN_1878
Enzymes [BR:ypn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     YPN_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABG18207
UniProt: A0A0H2YID6
Position
complement(2123580..2124134)
Genome map
AA seq 184 aa AA seqDB search
MSHPIYAISVQTIDHQLVKLAKYKGSVLLVVNVASQCGLTQQYEGLESLYKTYQKQGFEV
LGFPSNEFAGQEPGSDEEIHAFCRGTFGVDFPMFSKIEVNGPHRHPLYQHLVTAKPVAVK
PEGSEFYQRLASKGREPKQPGDILWNFEKFLISRDGTVLARFAPDMAPEAPILINAINQA
LASH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacccaatttacgccatttcagtgcaaacgattgatcaccagctggttaagttg
gcgaagtataaaggttccgttttattagtggtgaatgtggcttcgcaatgtggtttgact
cagcaatatgaaggattagaaagcctctataaaacctatcagaagcaaggttttgaggtt
ttaggtttcccgagtaatgagtttgcaggacaagagcctggcagtgatgaggaaattcat
gctttctgccgtggtacttttggtgtcgacttccccatgttcagtaaaattgaagtcaat
ggtccacatcggcatcctctatatcagcacttggttactgctaagcctgttgcagtgaaa
ccggaaggaagtgaattttatcaacgcctggcgagtaaaggccgtgagccaaaacagccg
ggtgatatcctatggaattttgagaaattcttgattagccgtgatggcactgtcttggcg
cgttttgctccagatatggcaccagaagcacctattttaatcaatgccatcaatcaggca
ctggctagccactaa

DBGET integrated database retrieval system