KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2183Help
Entry
YPN_2183          CDS       T00370                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase
  KO
K03473  erythronate-4-phosphate dehydrogenase [EC:1.1.1.290]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00750  Vitamin B6 metabolism
ypn01100  Metabolic pathways
Module
ypn_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YPN_2183
Enzymes [BR:ypn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.290  4-phosphoerythronate dehydrogenase
     YPN_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C DUF3410 2-Hacid_dh F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABG18512
UniProt: Q1CHL8
Position
complement(2467181..2468368)
Genome map
AA seq 395 aa AA seqDB search
MAYTKPPVFHLYGSSLSESKVKILVDENMPYAEELFRRLGDVQAVPGRPIPRDALVDADA
LMVRSVTKVNEALLHGTSIGFVGTATAGTDHVDDTWLRQQGIGFSAAPGCNAIAVVEYVF
SALMMMAERDGFQLRDKTVGIIGVGNVGSRLNARLQALGVRTLLCDPPRADRGDNEAFWP
LEKLVREADVLTFHTPLNKTGAYQSLHMADDELLAALPDGRILINACRGAVVDNAALLRA
LEKGKKLSVVLDVWEPEPDLSLPLLARVDIGTPHIAGYTLEGKARGTTQVFEAFSQHLGQ
PQSVELASLLPVPEFSHLRLNGELDEGKLKRLMHLVYDVRRDDAPLRHVAGLPGEFDRLR
KHYQERREWSSLCVQCDDATSAGLLQQLGFTTQLL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtggcttatactaagccccctgtttttcatctgtatggcagttcgctgtcggagagtaaa
gtgaaaattctggttgatgaaaatatgccgtacgctgaggagctgttccggcgtttaggt
gatgtacaggctgtgccagggcgtcccattcctcgtgacgcgttggttgatgccgatgct
ctgatggtacgttcggtcaccaaagtgaacgaggcgctgctacacggtacctcaattggt
tttgttggcacggcgacggcgggtaccgaccatgtcgatgacacttggctgcgtcagcag
gggatcggtttctctgcggcccccggttgtaacgccatcgccgtggttgaatatgttttc
tctgcgttgatgatgatggctgaacgggatggcttccagttgcgcgataaaaccgtgggc
attatcggcgtcggaaatgtgggttcacggctgaatgctcgtttgcaagccttaggtgtt
cggaccttgttgtgcgaccccccgcgtgctgatcgtggtgataacgaagccttctggccg
ctggaaaaactggtacgtgaggctgacgttctgaccttccatactccgctgaataaaacc
ggagcctaccaaagtctgcatatggccgatgatgaactgctggccgccttaccggatggc
cgtattctgatcaacgcctgccggggtgcggtggtggataacgcagcactattacgggcg
ctggaaaaagggaaaaaactcagcgtggtattggacgtctgggagccagaaccggatctc
tctttaccgctgttggcccgtgtcgatattggcacaccgcatattgccggatatacgcta
gaaggcaaagcacggggtaccacacaggtttttgaggcgttcagtcagcatttggggcaa
ccacagtcggtcgaactggcctctttattgccagtgccagagtttagccatttacgtcta
aatggtgagttggatgaaggcaaattaaaacgattgatgcacttagtgtatgatgtgcgc
cgcgatgacgcgccattgcgccatgtcgctggcctgccaggggagtttgaccgcctgcgc
aagcattatcaggagcggcgtgaatggtcatcactgtgtgtacagtgcgatgatgctacc
agtgctggactcttgcagcagctaggttttactactcaattgctgtga

DBGET integrated database retrieval system