KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2220Help
Entry
YPN_2220          CDS       T00370                                 

Definition
(GenBank) hypothetical protein
  KO
K11898  type VI secretion system protein ImpE
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypn02044]
    YPN_2220
Secretion system [BR:ypn02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   YPN_2220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpE TPR_12 Apyrase TPR_14
Motif
Other DBs
NCBI-ProteinID: ABG18548
UniProt: A0A0H2YJT8
Position
complement(2504979..2505785)
Genome map
AA seq 268 aa AA seqDB search
MNTTNLTELLKSASLTEMLADVIATIKAKPTDTDTRELLFKLYCIDGSWQKALLQLETLT
QLLPEFTKQAELYKNLILSEKMRDEVLAGKRSPGTLGNDLPEWVALLQQANQLHHDGDHQ
QSEALREQALQQAPESIGESAATGCFAWIADSDGRMGPVCEFISAGGYRWIPFAEIQSLT
VSKPKNITDLIWAPAQVKVKDKVWYGYIPARYPLTPETDNETKLGLKTEWHQPTDSLYIG
AGRKMFITDQGEHALFDIEEIVFEIDCI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaataccacgaatttaactgagttattaaaaagcgcgtctttaaccgaaatgctggcc
gatgtcattgctacgataaaagctaaaccaacggacaccgatacgcgagaactgttattc
aaactctattgtattgatggttcatggcaaaaagccctattgcagcttgaaacattgaca
cagcttttacctgagttcaccaaacaggctgaactctataaaaatctgatattgagtgag
aaaatgcgtgatgaagtgctggcaggcaaacgcagccctggtacattgggtaacgacctg
cctgaatgggtagccttgttgcaacaagctaatcaactccaccatgatggcgatcatcag
caaagtgaggccctccgtgaacaggctctgcaacaggcaccggaaagtatcggagagagt
gctgcgacaggctgcttcgcttggattgctgacagtgatgggcgcatggggcctgtttgt
gagtttattagcgccggcggttaccgttggatcccgtttgcagagatacaatcactcact
gtttccaaacctaaaaatattacagacctgatatgggcgccggcacaggttaaagtaaag
gataaagtttggtacggttatatacctgcccgctatccactgacacctgaaacagacaat
gaaactaaactgggtcttaaaacagaatggcatcaaccgactgactcactttatattggg
gcagggcggaaaatgtttatcaccgaccaaggtgagcatgcgctgtttgatattgaagag
attgtatttgagatagattgtatttga

DBGET integrated database retrieval system