KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2497Help
Entry
YPN_2497          CDS       T00370                                 

Definition
(GenBank) membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPN_2497
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypn02044]
    YPN_2497
Secretion system [BR:ypn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPN_2497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C T3SS_needle_reg DUF2271 Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: ABG18825
UniProt: A0A0H2YIU6
Position
complement(2802392..2805814)
Genome map
AA seq 1140 aa AA seqDB search
MKRIALPIKKPEVWFWIVALLFLLAGAVLCWLVWQHPERVGLIPGTPQRDRWLTGLVVGT
GILTLCALLSYAGTRLSGRKHFDELRQQAQGDDAPLPEDNAQAGETQQGEPSRLKTRLRR
RYGLFWRDKVRLLMVVGEPDEIAALAPQLAEQGWLEGQRTVLIHGGSLQRPADETGLSEW
RKLRRGRPLDGIVWAMTAAQSGTPQWMDNGLRTLEKMGAALRYQPPVYLWQVCDSDWPQD
SRTEQPVGAVFPAKATPEKVEQQLRALLPQLREQGMQQLSIEPHHDFLLRLAQSLDQGDA
ARWRQRLTPWFTEYAARIPLRGLMFSLPDTSASAAQVHEKSWTVPASWQGVLDDCRGARG
RRVGLPWEQTLCYSLLALIVLWGVGSVVSFAVNRHQMVSAAQQAQQLAQSHAVSDQQLMA
LQALRNDIGRLQSRVAQGAPWYQRFGLDHNAPLLEVLMPWYGQANNRILRDATAQSLYQK
LSELAELPANSPQRAARAKTGYDQLKAYLMMARPEKADAVFYAQVMQTTEPTRAGVSPGL
WQSLAPDLWQFYAQNLPAQPDWKITPDTGLISQVRQVLLGQMGQRNAESTLYENMLLSVR
RNYADMTLMDMTGDTDAQRLFQTSESVPGMFTRKAWDEQIQQAIDKTVASRREEIDWVLS
DNRRAISEDISPEALKKRLTERYFTDFAGSWLSFLNSLHWNEAHNLSDVIDQLTLMSDVR
QSPLIALMNTLAWQGQTGQQNQALSDSLVKSAKALMNKDQAPAIDQSAGGPVGPLDETFG
PLLALMGKGDAQNRLSSDSSLSLQTLLTRVTRVRLKLQQVVNASDPQEMTQVLAQTVFQG
KSVDLTDTQEYGSLIAASLGEEWSSFGQTMFVQPLTQAWETVLQPSSASLNDQWKNAVVA
NWKSAFDGRYPFAASKSDASLPMLAEFIRKDSGRIDSFLTRELGGVLHKEGTRWVPNKVN
SQGLTFNPAFLAAINQLSQISDILFTDGSQGLRFELLARPVPNVVETNLAIDGQKLHYFN
QMESWQSFRWPGETYKPGTMLTWTGVSSGARLYGDYQGTWGLIRWLEQAKQKKLDEGRYQ
LTFTTADKQPLQWILRTELGKGPLGLLQLRNFTLPAQIFLIQHAPLAIADMSDDEDMAED
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgcattgccttaccgattaaaaagccagaagtctggttctggattgttgccctg
ctgtttttgctggccggtgccgtgttgtgctggctggtctggcaacaccccgaacgggtg
gggttaattccggggacaccgcaacgtgaccgttggctgacgggactggtggtgggaacg
gggatcctgaccctgtgcgcattactgtcgtatgcggggacccggttatccggcagaaaa
cactttgatgagctacggcagcaggcacagggcgatgatgcgccgttgccggaagacaac
gcgcaggcgggtgagactcagcagggtgaaccgtcccgcctaaaaacccgcctgcgccgc
cgttacggtctgttctggcgcgacaaagtccggctgctgatggtggtgggtgaacctgac
gaaatcgccgcgctggccccgcaactggcggagcagggctggctggaagggcagcgcacg
gtgttgatacacggtggcagtttacaacgtccggcggatgaaaccgggctgagtgagtgg
cgcaaactgcgccgtggccgcccgttggatggcattgtctgggcgatgaccgccgcgcag
agtggcacgccacagtggatggataacggcctgcgaacgctggaaaaaatgggtgccgcc
ttgcgctatcaaccgccggtgtatctgtggcaggtctgtgacagcgactggcctcaggat
tcgcggacggagcagccggtcggggcggtgttcccggcgaaggctacgccagaaaaggtg
gagcagcaactgcgtgccctgttgcctcagttacgtgaacagggaatgcagcagctttcc
atcgagccgcaccatgatttcttgttgcgtctggcgcagtcactggatcagggcgatgcg
gctcgctggcggcagcgtctgacgccgtggtttaccgagtatgccgcgcgtattcccttg
cgtgggctgatgttcagtttacccgatacctctgcatcggcggcgcaggtacatgagaaa
agctggacggtaccggccagttggcagggggtactggatgattgccggggggcgcgtgga
cgccgtgtcgggctgccgtgggagcagacactgtgctacagcttgctggcactgattgtc
ttgtggggtgtgggcagcgtggtgtcatttgcggtcaaccgccaccagatggtctctgcc
gcacaacaagcacagcaactggcgcagtcgcacgcggtctccgaccagcaactgatggcc
ctacaagccctgcgaaatgatatcgggcgcttacaatctcgcgtggcgcagggcgcgccg
tggtatcagcgctttggtctggaccataatgcgccgctgcttgaggtcctgatgccgtgg
tatggtcaggccaacaaccgtattctcagggatgccaccgcgcagagcctgtatcagaaa
ctcagcgaactggcggagctgcccgccaacagcccgcaacgggcagcacgggcaaaaaca
ggctatgaccagttaaaggcttatctgatgatggcccgcccggaaaaagccgatgctgta
ttttatgctcaggtgatgcagaccaccgagcctacacgggccggtgtctcccccggtctg
tggcagagtctggcgcccgacttgtggcagttttatgcacaaaatctgcccgctcagccg
gactggaaaattaccccggataccgggttgatcagccaggtgcggcaggtgttgctgggg
cagatgggtcagcgcaatgcagaaagtacgctgtatgaaaacatgctgctgtcggtgcgc
cgcaactatgccgacatgacgctgatggacatgaccggcgataccgatgctcagcgtctg
tttcagacctcggaatccgtgcccggtatgttcacccgcaaggcctgggatgagcaaatc
cagcaggcgatagataaaacggtggcctcccgccgcgaagaaattgactgggtattgagt
gataaccgccgggcgatatccgaagatatctcaccggaagcgctgaaaaaacgcctgacc
gaacgttatttcaccgattttgctggcagttggctgagtttcctcaacagtttgcactgg
aatgaggcgcataacctgtcggatgtgattgaccaactgaccttgatgagtgatgtacgc
cagtcgccgctgattgcgctaatgaacacgctggcgtggcaagggcagaccgggcagcag
aatcaggcattatcggattcgctggtgaagtctgccaaggcgctgatgaataaagaccag
gctccggcgattgaccagagtgccggtgggccagtagggccactggacgagacctttggc
ccgttgctggcactgatgggcaaaggcgatgcacaaaacaggctgtcgtcggacagctcg
ctgagcctgcaaacgttgctcacccgcgtgacccgggtgcggcttaaactccagcaggtg
gtcaatgcttcggatccgcaggagatgacacaggtgctggcccagaccgttttccagggc
aaaagtgttgatctgacggacacgcaggagtacggcagcctgatagccgccagtctggga
gaggagtggagcagcttcgggcagacgatgtttgttcagccgctgacgcaggcgtgggaa
accgtgctgcaaccttcatcggccagtctcaacgaccagtggaaaaacgcggtggtggcc
aactggaaatcggcctttgatggccgctatccgtttgccgccagtaaaagtgatgcttca
ttgccgatgctggccgagtttatccgcaaggacagcgggcgcatcgacagcttcctgacc
cgtgaactgggcggcgtgctgcacaaagaaggaacgcgctgggtgccgaataaggtgaac
agccaggggctgacctttaacccggccttcctggcggcgattaatcaactgagccaaatc
tccgacatcttgttcactgacggcagtcaggggctacgctttgagctgctggcccgtccg
gtgccgaatgtggtggaaacgaatctggcgattgacggacagaaattgcattatttcaac
cagatggagagctggcagagtttccgctggccgggggagacctataaacccggcacgatg
ttgacctggactggtgtgagttcaggcgcccggttgtacggtgattatcaggggacatgg
gggctgatccgttggctggagcaggcaaaacagaaaaagctggatgaagggcgctatcaa
ctgaccttcaccaccgcagataaacagccattgcaatggatattacgcaccgagctgggc
aaaggcccgttaggcctgttgcaactgcgtaatttcactctgcctgcgcaaatttttctg
atacagcacgcgccgcttgcgattgctgacatgtcagacgatgaagacatggcagaagac
tga

DBGET integrated database retrieval system