KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2507Help
Entry
YPN_2507          CDS       T00370                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPN_2507
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypn02044]
    YPN_2507
Secretion system [BR:ypn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPN_2507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Sarcoglycan_1
Motif
Other DBs
NCBI-ProteinID: ABG18835
UniProt: A0A0H2YIV4
Position
complement(2815550..2817898)
Genome map
AA seq 782 aa AA seqDB search
MNTFLPTIRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIGPATML
MHDASLTLAAPMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRS
HQNGIYQDMSVPQIVEKILRERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLA
EVGIWFRFTADPKLNIDVVEFYDDQRFYQQGLTLQAVPPSGMHDSGMESVWDLSSAHQVV
EKSVSTGDYNYRTATADLTAGADITRGDTTTYGEAYHYADNYLTAGSEGREPESESGAFY
ARLRHERYLNNQARFAGVANAAALAPGQELNVTGNDVPAQFGKGVIITRITSHARRDRSY
EVHFEAIPYSEDYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWESGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSAHGDH
VTISNYKRNVLRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFE
LRTDSFGVLRAEKGLFITADGQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASP
ADLQVQISLLQQNLTELKQAVLLLSAPKGIALSSGEHLQMSASDNLIATAGKNADVSVAK
NFFIGVGNTLSIFVRKLGMKLIANQGPITVQAQNDLMELLARKAITITSTEDEIKITAKK
RITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAAKTEDPIKRWL
FS
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgaatacctttctcccgactattcggtttgaccatagccaccacaaactggtggtccgc
gacagcaccgccgccgttgatgtgctgggctttgaaggccatgaaagcctgagccagccg
ttctgttacgacatccaattcaccagcgccgacaaggcgattggcccggcgaccatgctg
atgcacgacgcgtcactgacattggcggccccgatggccgaagcttttggcgtgacggtt
cagcagacccagcgggtgatccaaggggtggtcaccggatttaaacgcctgtcggcctcg
aaagaggaatgccgctacgaactgagcctgcaaccgcgcctggccttgttatcgcgcagc
catcagaacgggatatatcaggacatgtcggtgccgcagattgtggaaaaaattctgcgt
gagcgccatgacatgcgcggtcaggattttgtcttcacgctggcccgcgagtacccacgc
cgcgagcaggtaatgcaatacggcgaggatgacctgacctttatccgccgcctgctggcc
gaggtggggatctggtttcgttttaccgccgatcccaaactcaatattgatgtggtggag
ttttacgacgaccagcgcttctatcagcaaggactgacgctacaggcggtgccgccttcg
gggatgcacgacagcgggatggaatcggtctgggacctgtccagcgcccatcaggtggtg
gaaaaatcggtcagtaccggcgattacaactaccgcaccgccactgccgacctgaccgcc
ggggccgacatcacgcgcggcgataccaccacctacggcgaagcctatcattacgccgat
aactatctgaccgcaggcagcgaagggcgcgagccggaaagtgaaagtggggccttttat
gcccgtctgcgccatgaacgttacctcaataatcaggcgcgcttcgccggggtggccaat
gcggcggcactggcaccgggtcaggaactgaacgtcaccggcaacgacgtgccagcacag
tttggtaaaggggtgataatcacccgcatcaccagccatgcccgccgcgaccgcagctat
gaagtacattttgaagccattccttactccgaggattattgcttccgtccggcgctgatc
cgcaagccgaccatggccgggaccttgccggcgcgggtgaccagtaccactgcgaacgac
acttatggtcatatcgacaaagacgggcgctaccgtgtcaacctgatgttcgaccgtgac
agttgggagtcgggttacgaaagcttgtgggtccgtcaggcccgcccgtatgcgggtgac
agctacggcctgcacctgccgctgctggcaggcaccgaagtggcgatcgcgtttgaagac
ggcaacccggaccggccgtatatcgcctatgtgctacacgactcggcgcacggcgaccat
gtcaccatcagcaactacaaacgcaacgtactgcgtactccgtcgaataacaaactgcgc
ctggaggatgaacggggtaaagagcacatcaagctcagcaccgaatatggcggcaaaagc
caactgaatctggggcatttggttgataacgagaaacagcctcggggtgagggttttgag
ctgcgcaccgacagttttggtgtattacgggcagaaaaaggcctctttatcactgccgac
ggacaggccaaagcacaggggcaggtgctggagatgcaaccggctatcagcctgttgaaa
agtgcgcaggaacagatggaggccatctccgcggatgcacaaaccgccaccgccagtccg
gccgacctacaggtacaaatcagtctgttgcagcaaaatctcactgaactgaaacaagct
gtcctgttactgagtgcgccaaaggggatcgcgttgagtagcggggagcatctgcaaatg
agtgccagcgataacctgattgccaccgccggtaaaaatgccgacgtcagcgtcgcgaaa
aatttctttatcggcgtaggcaataccctaagtatcttcgtcagaaagctggggatgaaa
ctaatagccaatcaggggccgataacagtccaggcgcagaatgatctaatggagttattg
gcgcgtaaagcgatcaccattaccagcaccgaggatgagataaaaatcaccgccaagaag
aggatcacgctgaatgcgggaggcagttatatcacgctggatgagaatcggatcgagtca
ggaacggcgggggaatatttgaccaaagcagggtattacgggcggttagataaggccaaa
ctcccaactgaatttccagccttagccgctaaaactgaagaccccattaaacgttggcta
ttctcttaa

DBGET integrated database retrieval system