KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2514
Entry
YPN_2514          CDS       T00370                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypn02044]
    YPN_2514
Secretion system [BR:ypn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPN_2514
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABG18842
UniProt: A0A0H2YKE5
Position
complement(2826796..2827296)
AA seq 166 aa
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNIN
KNNFNSVLAEFQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEPENVARQIPQLRALLAM
RNLLRDLKSNLLDNATFRRELENILKDDALSDELRAELAALAPKEG
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtcctcttcaagcttccaaaatgagatacctaaagcacgcattaacatcaaattagac
ctgcatactggcggggcgcaaaagaaagtcgaactgcctttgaagttgttggtgatgggc
gattacagcaacggtcaggagcagcgcccgctgtctgaacgtgaaaaactcaatatcaat
aaaaataattttaacagtgtgctggctgaattccaaccgagcctgaaactcgctgtaccg
gacacgctggccggggataacaccgatacagccgtctccctgaccttcaacgacatgaaa
gatttcgagccagaaaacgtggcccgtcaaattccgcaactgcgtgccttgctggccatg
cgcaacctgctgcgagaccttaaatccaatctgctggacaacgccaccttccgccgtgag
ctggaaaatatcctcaaagacgatgccttgagcgatgaactgcgcgctgaactggcggcc
ctggcgccaaaagagggttaa

DBGET integrated database retrieval system