KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2644Help
Entry
YPN_2644          CDS       T00370                                 

Definition
(GenBank) 23S rRNA (uracil-5-)-methyltransferase RumB
  KO
K03212  23S rRNA (uracil747-C5)-methyltransferase [EC:2.1.1.189]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ypn03009]
    YPN_2644
Enzymes [BR:ypn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.189  23S rRNA (uracil747-C5)-methyltransferase
     YPN_2644
Ribosome biogenesis [BR:ypn03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    YPN_2644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_U5-meth_tr Methyltransf_31 MTS Methyltransf_25 Methyltransf_15 Cons_hypoth95 Methyltransf_4 Methyltransf_32 Methyltransf_12 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: ABG18972
UniProt: Q1CGA8
Position
complement(2981409..2982539)
Genome map
AA seq 376 aa AA seqDB search
MHCAQYTAGRCRSCQWLDKPYPQQLADKQHHLESLLAGHAVTQWLAPVFGRESAFRNKAK
MVVSGSVERPLLGMLHRDGTPVDLCACPLYPPSFEPVFTVLKTFIARAGLTPYNVARKRG
ELKFLLLTESTYNGELMLRFVLRSETKLAQLIAALPWLQQQLPQLAVISANIQPVHMAIL
EGEREIPLTEQQALPERFNQVPLYIRPQSFFQTNPQVAASLYATARQWVQEHEVHSMWDL
FCGVGGFGLHCAGPETQLTGIEINAEAIACARQSAEQLGLKNVSFAALDSTRFATAEAQI
PELVLVNPPRRGIGRELCDYLSQMAPKFILYSSCNAETMAKDISLLAGYHIERVQLFDMF
PHTSHYEVLTLLTLRR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcattgcgcacagtatacggcaggtcgctgccgttcttgtcagtggttggataaaccc
tatccacaacaactcgctgataaacagcatcatctggaaagcctgttggctggtcatgcg
gtcacccagtggctagcaccggtttttgggcgcgagagtgcctttcgtaacaaggcgaaa
atggtcgtcagcggcagtgtggaacgcccgttactgggtatgctgcatcgtgacggtaca
ccggttgatttatgcgcatgtccactttatccgcccagcttcgaaccggtatttacggta
ctgaaaacctttattgccagggcgggtttgactccctataacgttgctcgcaagcgtggc
gaacttaaattcctgttactcacggaaagtacctacaacggtgaattgatgctgcgcttt
gtgctgcgttctgaaactaaattagcgcagttaattgctgcgttgccgtggctgcaacaa
cagttgccgcagttggcggtgatctcggctaatattcagccagtgcatatggccattctg
gaaggggagcgggagatcccgctgaccgaacaacaggccctgcctgagcggtttaatcag
gtgccgttgtatatccgcccacaaagttttttccagaccaatccacaggtggcggcttcg
ttgtatgcaacagcacggcagtgggtgcaggagcatgaggttcacagtatgtgggatctg
ttctgtggtgtgggcggctttggtttacattgtgcggggccagagactcaattgaccggc
attgaaatcaatgctgaagctatcgcctgtgcccgccagtcggctgagcagttagggcta
aaaaatgtcagtttcgccgcgctggattctacccgctttgctaccgctgaagcccaaata
cctgaactggtcttggtgaatccaccacggcgggggatcggccgcgagttatgtgattac
ctgagccagatggcacctaaatttattctctattcaagttgtaatgcagagacgatggcg
aaagatatcagtttgcttgcgggttaccacattgaacgggtacagctgtttgatatgttc
ccgcataccagtcactacgaagtgctcaccttgctgactctccgtcgctag

DBGET integrated database retrieval system