KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_3175
Entry
YPN_3175          CDS       T00370                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypn02044]
    YPN_3175
Secretion system [BR:ypn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPN_3175
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ABG19502
UniProt: A0A0H2YJZ2
Position
complement(3580308..3581846)
AA seq 512 aa
MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDE
RVTAAVSVFLDLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWR
GVKSLIDQTDFRQNVRIELLDISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIA
AAISNYEFDRSPQDIALLRNISKVAAAAHMPFIGSVGPEFFGKENMEDVAAIKDIANYFD
RAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVRSFNYVEQVKGPDHDRYLWTN
ASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQVKIPSEVMIPETRE
FEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKLIQRENIGTTKDRRLLELNNWVRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPG
FFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgtctgtacaggaaaaccgtgcgcagggtactgcgacgaccgtattaaagaatagccct
gcggcacaaggggtttacgccgccttgtttgaaaaaatcaacctgagcccggtctcctca
ctggccggtatcgaggcgttccagaacaacgatgcgctggcggaagccaccaccgatgag
cgcgttaccgccgccgtcagtgtctttttagacctgctgaagcagtcggcgaagaaagta
gaaaaactggataaaaccctgctggacggccatattgccgcactggatgaccaaatcagc
cgccagttggacgcggtaatgcaccaccccgatttccagcgggtggaatcgacctggcgt
ggtgtgaagtcgctgatcgatcagaccgatttccgccagaacgtgcgcatcgagctgctg
gatatcagtaaagatcatctggtgcaggattttgaagatgccccggaaatctcacaaagc
ggtttatacgcccagacctatattcaggaatacgacacccccggcggcgagccgattgcc
gcggctatctccaactacgagttcgaccgtagcccgcaagatatcgcgttattgcgcaat
atctccaaggtcgcggcggcagcccatatgccgtttatcggttccgttggccccgagttc
tttggtaaagagaacatggaagacgtggcagccatcaaagatatcgccaactactttgac
cgtgctgaatacatcaagtggaaagccttccgcgactcggatgattcccgctatatcggc
ctgaccatgccgcgcgtgctggggcgtttgccttacggcccggacacggtgccggtacgc
agcttcaactacgttgagcaggtgaaagggccggatcatgatcgctacttgtggaccaat
gcctcatttgcctttgctgctaacatggtgaaaagcttcattaaaaatggctggtgtgtg
cagatccggggcccgcaggccggtggtgcggtcaccaacttaccgatccacctgtacgat
ctgggtaccggtaatcaggtcaaaattccgtcagaggtgatgatcccggaaacccgcgag
ttcgagtttgccaatctgggctttatcccgctgtcgtactacaaaaaccgcgattactcg
tgcttcttctcggccaactcggcgcagaaaccggcgctgtatgacaccgcggatgccacg
gccaacagccgcatcaacgcccgtttgccgtatatcttcctgctgtcgcgcattgcccat
tatctgaaactgatccagcgcgagaacatcggcaccaccaaagatcgccgtctgctggag
ctgaacaactgggtgcgcgggctggtgacggaaatgactgatccgggtgatgatttgcag
gcgtcccatcccctgcgtgatgccaaagtgacggtcgaagatatcgaagacaaccccggc
ttcttccgcgtcaagctgtatgcggtgccgcatttccaggtggaagggatggacgtcaat
ctgtcattggtttcccaaatgccaaaggctaaggcataa

DBGET integrated database retrieval system