KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_3470Help
Entry
YPN_3470          CDS       T00370                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00240  Pyrimidine metabolism
ypn00250  Alanine, aspartate and glutamate metabolism
ypn01100  Metabolic pathways
Module
ypn_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YPN_3470
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YPN_3470
Enzymes [BR:ypn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     YPN_3470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace BRCT
Motif
Other DBs
NCBI-ProteinID: ABG19797
UniProt: Q1CDY3
Structure
PDB: 

Position
3953141..3954076
Genome map
AA seq 311 aa AA seqDB search
MANPLYHKHIISINDLSRDELELVLRTAASLKKTPQPELLKHKVIASCFFEASTRTRLSF
ETSIHRLGASVVGFSDSSNTSLGKKGETLADTMSVISTYVDAIVMRHPQEGASRLAAQFS
GNVPIVNAGDGANQHPTQTLLDLFTIQETQGRLDNINIAMVGDLKYGRTVHSLTQALAKF
NGNHFFFIAPDALAMPAYILQMLEEKEIEYSLHESLEEVVPELDILYMTRVQKERLDPSE
YANVKAQFILRSSDLTGARDNLKVLHPLPRIDEITTDVDKTPYAYYFQQAGNGIFARQAL
LALVLNAELAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccaatccgttgtatcacaaacatatcatctcaattaacgatttaagtcgcgatgaa
ctagaactggtcttgcgtactgcggccagcctgaaaaagactccgcagccagagttgtta
aaacataaagtgatcgccagttgcttttttgaagcgtcgacccgcacccgcttgtcattt
gaaacatccattcaccgcctgggtgcctcggtcgtgggcttttctgatagcagcaatacc
tcattgggtaagaaaggcgagacactggcagacaccatgtcagtcattagcacttatgtt
gacgccattgtgatgcgccatccacaagaaggggcttcacgtctggccgcgcaattctcg
gggaatgtgcctatcgtgaatgccggtgacggcgcaaaccagcacccaacacaaaccctg
ctcgatttattcactattcaggaaacgcagggccggctggataacatcaatatcgccatg
gtaggtgacctgaaatatggccgtaccgtgcattcattgacgcaagcgctggcaaaattc
aatggcaaccacttcttctttatcgcccctgatgcgctggcaatgcccgcttatattttg
caaatgttggaagaaaaagagattgagtacagcctgcatgaaagcctcgaagaggtggta
ccggagttagatattctctatatgactcgcgtacagaaagagcgccttgacccatcggaa
tatgccaatgtcaaagcacagtttattttgcgctcttctgatttaacgggcgcacgggat
aatcttaaagtgttgcacccgctgccacgtattgacgaaatcacaaccgatgtcgataaa
accccctacgcctactatttccaacaagcgggtaacggtatttttgcacgtcaggcgcta
ctggcactggtattaaacgcagaattagctctttaa

DBGET integrated database retrieval system