KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_3566Help
Entry
YPN_3566          CDS       T00370                                 

Definition
(GenBank) Rhs accessory genetic element
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPN_3566
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypn02044]
    YPN_3566
Secretion system [BR:ypn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPN_3566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD SIN1 Ribosomal_L5e
Motif
Other DBs
NCBI-ProteinID: ABG19893
UniProt: A0A0H2YMT2
Position
complement(4070342..4072744)
Genome map
AA seq 800 aa AA seqDB search
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQA
AEVAKTALDAKAKVLDGGVTPTNIVATGPAPTVSGAQMTEMAGGIGDAVGGTAGKRINQA
AEVAKTALEAKAKVLDGGVTPMNLAAGGAGAGLPDSAAAAISRLVKQPSGLQFTLTTASL
PPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGM
VASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVEEIITTLLKENGINDFAFG
FRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDVGSLPKGASLP
YNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAW
QLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGP
PGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDF
LHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFRSKTHKGEGYNEMRFEDAKGGEGLFM
HAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTVVRNQSNTIQNDRRVEVTRDQQTEVGN
DYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQGDISISTPNAGITITHDGAI
VLQGKYIRLAADMIDLNPEE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctcatgataaagctaataataataaagccgcggacaagaccggcacggtgacg
ccgacccatatcgtctcgccggaggccgccccaaccgtgagtggcgctcagatgaccgag
atggccggggggattggggatgcggtgggcggcactgccggtaagcgcatcaatcaggcc
gccgaggtggcaaaaaccgccctggatgccaaagcaaaagtactggacggcggcgtcacg
ccgacgaacattgtggccactggcccggccccaaccgtgagtggcgctcaaatgaccgag
atggccggggggatcggggatgcggtgggcggtactgccggtaagcgcattaatcaggcc
gccgaggtggctaaaaccgccctggaggccaaagcaaaagtactggacggcggcgtcacg
ccgatgaatctggccgcgggcggggccggtgcgggattgccggacagcgccgcggcggcg
atatcccgcctggtcaaacagccctccggcctgcaatttaccctgacgacggccagttta
ccgccccagacctttgcggtggtggatttcaccctgagcgagatgctctcctcgccgttt
gtgctcaatgtcgggctggcgagtgccgatccggcggtggattttgcggcggtattggat
gaagacgccacgctgtttatctggcgcgaaggggtactgcaacgcagcatcaccggcatg
gtcgccagctttgaacagggcgataccggttttcatcagacccgctacagcatggtgatc
cgcccggcgctgtggcgcaccagcctgcggcgcaatgcccgcatcttccagcaagcctcg
gtggaagagatcatcaccaccctgctgaaagagaacggcatcaacgattttgcttttggt
tttcgccacccgcacccggtgcgcgagttctgcgtgcaatatcaggagtccgattttgat
tttatccagcgcctgacggcagaagaggggattttctactacttcgagttcagcgccggg
aaaaataccgtggtgtatgccgatgatgttggctccctgccgaaaggcgcgtcactgccc
tataacccgaatgtggcggcgcaggcgcaggaactgagtatcaccaccttcacccgcagt
gcgcaggtgcgcccggcgatggtgcaactgaaagactacacctttaaaaacccgaactgg
gccgcggccttcagcgaacagtcgggagaactgcaaaaccagcgaccggactacgagcat
tttgattttccggggcgcttcaaagatgcccagcacgggcaggattttacccgctaccgg
ctggacgcgctgcgcaatgacgccaatctggggcagggggccagcaatgattttaccctc
cagccggggcagttgttcagcctgtacaaccacccgcgtggtgatctgaaccacgcctgg
cagttgctcggtattcagcacagcggcaaacagatgcaggcgctggagcaggcatctggc
gatcagggcacggtgctgttcaaccacttcagttttattccgcacacccagacctggcgg
ccgacgccgttggctaaaccggcgatggacggcccgcagatcgccatggtggtggggccg
ccgggggaagagatttactgcgacgaatacggccgcatccgcctgcaatttttatgggat
cgctacgggcagagcaatgacaacagctcctgttggatccgggtaacccagccgtgggcg
ggccagggctggggcatgctggccattccgcgtattggtcaggaagtggtggtggatttt
ctgcacggcgatccggatcaaccgattgtcacggggcggacctatcacgccaacaacatc
ccgccggggtcgttaccggccagtaaaacccagatggcgttccgctcaaaaacccacaaa
ggggaaggctacaacgaaatgcgcttcgaggatgccaaaggcggcgaagggctgtttatg
catgcgcagaaagatatgacgaccatggtgctgaatgatcgcaaaaccgatgtgactcag
gaccattcagagcacattgggcaagatcagtccgtgacggttgtgcgtaaccaaagtaat
acgatccaaaatgatcgccgggtagaggtgactcgcgatcaacaaaccgaagtgggcaat
gattaccagctagtggtgaaaggtgaaaagaaagagtttgtgacgaaaattcgttacacc
gaagtgcatgaagacgaaacgctcacggtgacgaaaagtattaaaatccatgccaaacaa
ggtgatatcagcatatcaaccccgaatgccggaattacgatcacccatgacggtgccatt
gttctgcaagggaaatacattcgtttagcggccgatatgatcgatcttaatccagaggag
tag

DBGET integrated database retrieval system