KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_3737Help
Entry
YPN_3737          CDS       T00370                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00670  One carbon pool by folate
ypn01100  Metabolic pathways
ypn01120  Microbial metabolism in diverse environments
ypn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    YPN_3737
Enzymes [BR:ypn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     YPN_3737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ABG20064
UniProt: A0A0H2YN82
Position
complement(4287892..4288776)
Genome map
AA seq 294 aa AA seqDB search
MSFFHANQREALNQSLSELQGQINVSFEFFPPRTSEMEDTLWSSIDRLSTLKPKFVSVTY
GANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASPTQLRDIAIDYWNSGIRHIVALRGD
LPPNSGKPEMYACDLVGLLKDVGDFDISVAAYPEIHPEAKSAQADLINLKRKIDAGANRA
ITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFKQLQRFATMTNVRVPNWMTSIFD
GLDNDPETRKMVGASVAMDMVKILSREGVKDFHFYTLNRAELSYAICHTLGVRP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttttcacgcaaaccagcgagaagcgctgaaccagagtctgtctgagctacaa
ggtcagattaatgtttcttttgagttcttcccgccgcgcaccagcgagatggaggatacc
ctgtggagctcgattgatcgtcttagcacgttgaaacctaaatttgtttccgtgacctat
ggggcgaactcgggtgagcgtgaccgtactcacagcatcatcaaagggattaaggagcgc
acaggcctggaagctgcgccgcatctgacctgtattgatgcttctccgactcagttgcgt
gatatcgcgattgactactggaatagcggtatccgacatatcgttgccttacggggtgat
ttgccgccaaacagcggaaaacccgaaatgtatgcctgcgatttggtgggtttgctaaaa
gatgtgggtgattttgatatctccgtggcggcgtacccagaaattcatccagaagcgaaa
agcgcccaagctgacttgatcaatctgaaacgtaagattgatgcaggtgctaaccgggcc
atcacccaatttttctttgacgttgagagttacctgcgttttcgtgaccgctgtgttgcc
accgggattgacgttgagatcgtaccgggcattttgccggtttctaattttaagcagtta
cagcgttttgccaccatgaccaatgtgcgggtcccaaattggatgacatctatttttgac
ggtctggataatgacccagagacgcgcaaaatggtgggggcatcggtcgcgatggacatg
gtgaagatcctcagccgcgaaggggtgaaggatttccatttttatacgttgaaccgggct
gagttgagttatgcgatttgtcatacccttggggtgaggccttag

DBGET integrated database retrieval system