KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_3763Help
Entry
YPN_3763          CDS       T00370                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00010  Glycolysis / Gluconeogenesis
ypn00051  Fructose and mannose metabolism
ypn00562  Inositol phosphate metabolism
ypn01100  Metabolic pathways
ypn01110  Biosynthesis of secondary metabolites
ypn01120  Microbial metabolism in diverse environments
ypn01130  Biosynthesis of antibiotics
ypn01200  Carbon metabolism
ypn01230  Biosynthesis of amino acids
Module
ypn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypn_M00002  Glycolysis, core module involving three-carbon compounds
ypn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPN_3763
   00051 Fructose and mannose metabolism
    YPN_3763
   00562 Inositol phosphate metabolism
    YPN_3763
Enzymes [BR:ypn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YPN_3763
Exosome [BR:ypn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YPN_3763
  Exosomal proteins of bladder cancer cells
   YPN_3763
  Exosomal proteins of melanoma cells
   YPN_3763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABG20090
UniProt: Q1CD40
Position
4316860..4317627
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAIYLNQAKHELAGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQESDELIAKKFGVLKEIG
LIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAKAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaagctgaacggtagtactcatatggttaac
gagcttatcgctggcctgcgtaaagaattgagcaccgttgatggttgtggcgttgccatt
gccccaccggcgatctatctaaatcaggcaaaacatgagcttgctggtagccgtattgct
ctgggtgctcaaaacgtcgatgtgaacctctccggcgcatttaccggtgaaacatctgct
gaaatgctgaaagatatcggtgcgcaatacattattatcggccactctgagcgccgtact
tatcaccaagaaagtgatgaattgatcgcgaagaaatttggcgtactgaaagagatcggc
ttgatcccagtattgtgtatcggtgagtccgaagcagaaaacgaagcgggccaaactgaa
gcagtatgcgccaaacaactggacgccgtgctgaataccctaggcgtgaaagcgttcgaa
ggtgcggttatcgcttatgagccaatctgggctatcggtaccggtaaatcagcaactcca
gcgcaggctcaggctgttcacaaatttatccgtgaccatatcgccaagcaagacgcagca
gttgcagcacaagtgatcattcagtacggcggttctgttaacgataaaaacgcagcagaa
ttgttcactcagccagatattgatggcgcactggttggcggtgcatcactgaaagcagac
gctttcgcagttatcgtgaaagcagccgctaaagctaaaaaagcctaa

DBGET integrated database retrieval system