KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_3854Help
Entry
YPN_3854          CDS       T00370                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YPN_3854
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ypn03011]
    YPN_3854
Ribosome [BR:ypn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    YPN_3854
  Bacteria
    YPN_3854
  Archaea
    YPN_3854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF733
Motif
Other DBs
NCBI-ProteinID: ABG20181
UniProt: Q1CCU9
Position
complement(4395223..4395555)
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAGLVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacatcgccacgctcgttcttctgctcagaaggttcgcttggta
gcggacctgattcgcggtaagaaagtgtcgcaagctctggaaactctaacctacaccaac
aaaaaagctgctggtttggttaagaaggtactagagtctgccattgctaacgcagaacac
aacgatggcgctgacatcgatgatctgaaagtcacgaagatcttcgtagacgaaggccct
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system