KEGG   Yersinia pseudotuberculosis IP 32953 (serotype 1): BZ17_1292Help
Entry
BZ17_1292         CDS       T03832                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ypo  Yersinia pseudotuberculosis IP 32953 (serotype 1)
Pathway
ypo00350  Tyrosine metabolism
ypo00360  Phenylalanine metabolism
ypo00380  Tryptophan metabolism
ypo01100  Metabolic pathways
ypo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BZ17_1292
   00360 Phenylalanine metabolism
    BZ17_1292
   00380 Tryptophan metabolism
    BZ17_1292
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypo04147]
    BZ17_1292
Enzymes [BR:ypo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     BZ17_1292
    4.1.1.105  L-tryptophan decarboxylase
     BZ17_1292
Exosome [BR:ypo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BZ17_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AJJ54206
UniProt: Q66D15
Position
complement(1425840..1427255)
Genome map
AA seq 471 aa AA seqDB search
MTPEEFRRHGYAMIDLIADYRQNIELRGVNPTTAPGEIKSRLSLNAPEKAEPFEHIISDI
EELIMPGLLHWQHPDFFGYFPSNVELSSVLGDCLSTGLGVIGLSWQSSPALTEIEEVATN
WLLKMLGLSVAWSGVIQDSASTATLVALISGRERTSNYALMNKGMQNSDAPLIVYTSSEA
HSGVNKAALLAGFGHNNTRLVPTDEHNAMSPLALKKIIQQDLVKGNRPCIVVATTGTTAA
TAMDPLDAIGDITQRYGLWLHVDSAMAGSAMILPECRHLWCGIEKADSVVINPHKWLGAA
FDCSVYCVQDSEHLIRIMSTNPSFLQSDADGKVRNYRDWGIPLGRRFRALKLWFLIREQG
GEGLQARLRRDIANANWLAEQIKNSDDWKLVAPVVLQTLCIRHEPGGLMGDALDNYTRSW
AEKLNQSGKGYVTPATLGGRWMVRVSIGTLGTERHHVEKLWLLLQSLVKER
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgactcctgaagagtttcgccgccatggctatgccatgatcgacctgattgctgattac
cgacaaaatatcgaattgcgtggcgttaatcccacgacagcacccggtgagattaaatct
cgtctgtcgttaaatgcacctgaaaaagcagaacctttcgaacacattatttctgacata
gaagagctcatcatgccagggctattacattggcaacatcctgacttttttggttatttt
ccttctaatgtagagttatcctccgttcttggggattgcttgagtactgggctgggggtg
ataggtctgtcttggcaatccagcccggccctgacagaaattgaagaggtggccaccaat
tggttgctaaaaatgcttggtcttagcgttgcctggagtggcgtgattcaggattccgcc
tcaaccgccacgttagtggcgctgatcagcggccgagagcgaacatctaactatgcatta
atgaataaagggatgcaaaacagtgatgcacctttgattgtctacacttcatcagaagcc
catagcggagtgaataaagccgctctgctcgctgggtttggtcataataatacccgttta
gtgcccaccgatgagcacaatgccatgtcacccttggcattaaaaaagatcattcaacag
gatttggtgaagggaaaccggccttgtatcgttgttgctacgacaggtactaccgctgcg
acagcgatggatccccttgatgcgattggtgatattactcagcgttatggtttatggctg
catgtggattctgctatggctggttcagcgatgattttgccagaatgccgtcatctgtgg
tgcggtatagaaaaggctgattctgtggtgataaatccgcataaatggctgggtgctgct
tttgattgttcggtttattgtgtacaagattcagagcatttgattcgtatcatgagtact
aaccccagtttcttacaatccgatgccgatgggaaagtgagaaattaccgcgattggggg
atccccctgggtcgtcgttttcgtgcgcttaagctatggtttctaatccgtgagcaaggg
ggggaagggctgcaggcgcgtttgcgtcgtgatattgccaatgctaattggttagcagaa
caaattaaaaacagcgatgattggaaactggtcgcacctgtagtgttgcaaaccttgtgt
attcgtcatgaaccgggtgggctgatgggcgacgcgttggataattatacccgcagttgg
gccgagaaactcaatcaatctggtaagggttatgttacaccagccacgcttggtggccgc
tggatggtgcgggtttccatcggcactttgggtacggaacgtcatcacgttgagaagttg
tggttgttgttgcagtctttggttaaggagagataa

DBGET integrated database retrieval system