KEGG   Yersinia pseudotuberculosis IP 32953 (serotype 1): BZ17_1537Help
Entry
BZ17_1537         CDS       T03832                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
ypo  Yersinia pseudotuberculosis IP 32953 (serotype 1)
Pathway
ypo00051  Fructose and mannose metabolism
ypo00520  Amino sugar and nucleotide sugar metabolism
ypo01100  Metabolic pathways
ypo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BZ17_1537
   00520 Amino sugar and nucleotide sugar metabolism
    BZ17_1537
Enzymes [BR:ypo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BZ17_1537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 Peptidase_M10 IspD
Motif
Other DBs
NCBI-ProteinID: AJJ54529
UniProt: Q66DN2
Position
complement(1681366..1682772)
Genome map
AA seq 468 aa AA seqDB search
MLLPVIMAGGAGSRLWPLSRALYPKQFLALTSDLTMLQETLLRLDGLPHLAPLVICNEEH
RFIIAEQLRQKNLVHSGIVLEPVGRNTAPAIALAALRATMSGDDPLLLVLAADHVIQDKL
AFIRAVQRAEPLAEAGKLVTFGIVPKSPETGYGYIRQGKQVVDGAYQVAAFVEKPDLITA
ERYLASGDYYWNSGMFVFKASRYLQELDLHRPDILAACKQAIAGQHTDLDFIRLNEEAFS
SCPDESIDYAVMEKTSDAVVVPLDAQWNDVGCWSALWEINTKDDHGNVIRGDVLIEDTNN
SYVYSQNRLIATVGINDLVIVETKDAILVAHKDKVQNVKGIVGQLKLESRCEYLQHREVY
RPWGSHDAIAEGVRYHVQHVTVKPGQRIATQIHYHRAEHWIVVSGIAKVHYGKETYLVNE
NESTYIPVGIAHSIENPGQIPLEIIEVHTGNYISEDDVERIDDLGVGY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgctattacctgtaattatggctggaggtgctggtagccgtttgtggccattatcccga
gctctttatcctaaacaatttctagcgctaacgtcagatttgacgatgctacaagaaacc
ctattgcgtctggacggtcttccccaccttgcaccattagtgatttgtaacgaagaacat
cgctttattatcgcagaacagttgcgtcagaaaaatctggtgcatagcggaatagtcttg
gaacctgttgggcgcaataccgcgccagctatagcattggctgccttacgagcaacaatg
agtggggatgatcctctattattggtattagcagccgatcacgtgattcaggataaactt
gcatttattcgtgccgtccaacgtgctgaaccgcttgctgaagcgggaaaattggttact
tttggaatcgtgccaaagagtccggaaacaggatatggatatattcgccaagggaagcaa
gtcgtagatggcgcttatcaggttgctgcttttgttgagaagccagatctgattactgca
gagcggtatttggcttcgggtgactattattggaatagcggtatgtttgtatttaaagca
tctcgctatctacaggaattagatctacatcgtccggatattttggctgcctgcaagcaa
gccattgctggtcaacatactgatttagattttattcgtctcaatgaagaagctttctct
agttgccctgatgaatctatcgactatgctgtgatggaaaaaactagcgatgccgttgta
gtgccactggatgcacagtggaatgatgttgggtgctggtcagcgctttgggaaattaat
actaaagatgaccatggtaatgttattcgtggtgatgtattaatagaagatactaataat
agctacgtttattctcaaaataggctcattgcaactgtaggcattaatgatttggttatt
gttgaaactaaagatgccattttagttgctcataaagataaagtacaaaatgttaaaggg
atcgttggacagcttaagcttgaatctcgatgtgaatatctacagcaccgggaagtctat
cgcccttggggttcgcatgatgctattgctgaaggtgttcgctaccatgtccaacatgta
acggtgaaaccaggtcaacgtattgctactcaaattcattatcacagagcggaacattgg
attgtggtttctggcattgccaaagtacattatggaaaagaaacttatttggttaatgag
aatgaatccacttatattcccgtcggcattgctcattctattgaaaatccaggtcagatc
cctctggaaataatagaggttcatactggtaattacatttcagaagatgatgtggaacga
atcgatgatttaggtgtagggtattaa

DBGET integrated database retrieval system