KEGG   Yersinia pseudotuberculosis IP 32953 (serotype 1): BZ17_4032Help
Entry
BZ17_4032         CDS       T03832                                 

Definition
(GenBank) ABC transporter family protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
ypo  Yersinia pseudotuberculosis IP 32953 (serotype 1)
Pathway
ypo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ypo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BZ17_4032
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypo02000]
    BZ17_4032
Enzymes [BR:ypo01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     BZ17_4032
Transporters [BR:ypo02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BZ17_4032
   Histidine transporter
    BZ17_4032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 ABC_ATPase AAA_23 AAA_16 PRK G-alpha RsgA_GTPase AAA_24 AAA_33 AAA_22
Motif
Other DBs
NCBI-ProteinID: AJJ54409
UniProt: Q668Y0
Position
4557029..4557826
Genome map
AA seq 265 aa AA seqDB search
MTNTSYIKNAETKLSVTELHKHYGEHEVLKGVSLSANAGDVISIIGSSGSGKSTFLRCIN
FLEKPSEGSISVNNQVIRLVRDSDGQLKVFDKKQLQLLRTRLTMVFQHFNLWSHMTVLEN
VMEAPIQVLGLSKSVAKERAILYLDKVGIDERARAKYPVHLSGGQQQRVSIARALAMEPD
VLLFDEPTSALDPELVGEVLRIMQKLAEEGKTMVVVTHEMEFARHVSSHVIFLHKGVIEE
EGPPAELFGNPKSPRLQQFLSGSLK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatacgtcctatattaaaaatgcggaaacaaaactttccgtgacggagctgcat
aagcattatggggagcatgaggtattaaaaggtgtttcgctctctgccaacgcgggggat
gttatttccattattggttcatccggttcagggaaaagtacatttttacgttgcattaac
tttctggaaaaacccagtgaaggatcgataagcgtgaataatcaggttatccgcttggta
cgggatagcgatggtcagttaaaagtcttcgataaaaaacaactgcaattattgcgcacc
cggttaacgatggtcttccaacactttaatctgtggagtcacatgacggtattagaaaac
gtgatggaggcaccgattcaagtgctgggattaagtaaatcggtggcgaaagagcgtgca
attttgtatctggataaagtcggtattgatgaacgggcgcgggccaaatatcccgtacat
ctctctggggggcagcaacagcgtgtttctattgcacgagcactggccatggaaccagat
gtattgctgtttgatgaacccacttcggcgctggatcctgagttggtcggtgaagtgcta
cgtattatgcaaaagttggcggaagaggggaaaactatggtggtggtcacgcacgaaatg
gaatttgcccgccatgtttccagccatgttattttcttacataaaggggtcattgaagag
gaagggccacccgctgagcttttcggtaaccctaaaagcccacgtttacagcagtttctt
tctggctcactgaaataa

DBGET integrated database retrieval system