KEGG   Yersinia pseudotuberculosis IP 32953 (serotype 1): BZ17_416Help
Entry
BZ17_416          CDS       T03832                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ypo  Yersinia pseudotuberculosis IP 32953 (serotype 1)
Pathway
ypo00030  Pentose phosphate pathway
ypo00480  Glutathione metabolism
ypo01100  Metabolic pathways
ypo01110  Biosynthesis of secondary metabolites
ypo01120  Microbial metabolism in diverse environments
ypo01130  Biosynthesis of antibiotics
ypo01200  Carbon metabolism
Module
ypo_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ypo_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ypo_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ypo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BZ17_416 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BZ17_416 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypo04147]
    BZ17_416 (zwf)
Enzymes [BR:ypo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BZ17_416 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BZ17_416 (zwf)
Exosome [BR:ypo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BZ17_416 (zwf)
  Exosomal proteins of colorectal cancer cells
   BZ17_416 (zwf)
  Exosomal proteins of bladder cancer cells
   BZ17_416 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AJJ55868
Position
complement(480102..481577)
Genome map
AA seq 491 aa AA seqDB search
MNTVQVAQACDLVIFGAKGDLARRKLLPSLYQLEKAGHIHPDTRIIGVGRAEWDKDAYTA
VVKEALDTFMKEPLDDELWQKLSSRLDFCNLDVNDSKHFTKLGKMLDQKHRTTINYFAMP
PSTFGAICKGLGEAGLNKEPSRVVMEKPLGTDLASSRVINDQVAEYFNECQVYRIDHYLG
KETVLNLLALRFANSLFASNWDNRTIDHVQITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILTMIAMSPPADLSTDRIRDEKVKVLRSLRRIDHTNVRETTVRGQYTAGFVQGNKVPG
YLEEEGANKNSNTETFVSIRVDIDDWRWAGVPFYLRTGKRLPSKCSEVVVYFKNPALNLF
RESYQQLPQNKLTIRLQPDEGIEIEVLNKVPGLEHKHRLQTTKLDLSFSKTFNEQHIADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSIMNAWAADNEAPKPYQSGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagtccaggtagcccaggcgtgtgacctggtgattttcggcgctaaaggtgat
ttggctcgccggaaactgctgccttctctttaccaattagaaaaagcgggtcatatccac
ccagatactcggataatcggtgttggccgtgctgagtgggataaagatgcgtacaccgct
gtggtaaaggaagccctcgatacctttatgaaagagccgctggatgacgagctatggcaa
aaactcagctcgcgcctcgacttctgcaatctggatgtgaatgacagtaagcatttcacc
aaattaggtaaaatgctcgatcaaaaacatcgcaccacgattaactactttgctatgccg
ccgagtacatttggtgcgatttgtaaaggcctgggagaagccgggttaaacaaagagcct
agccgagtggtaatggaaaaaccattgggaaccgatttagcgtcctcaagggtaattaac
gatcaggtagccgagtatttcaacgaatgtcaggtttaccgtattgaccactatttaggg
aaagaaacggtattaaacctgttggcgcttcgcttcgctaactcgttgttcgcctcaaac
tgggacaaccgcactatcgatcatgtgcaaattaccgtcgcagaagaggtcggaattgaa
gggcgttggggctattttgatcaggccggtcagatgcgtgacatgatccaaaaccatctg
ttgcaaatcctgacgatgatcgccatgtcaccccccgcagatctcagtacggatcgcatc
cgtgatgaaaaagtaaaagtactgcgttcgctgcgccgtattgatcacaccaatgtgcgc
gaaactacagttcgtgggcaatatactgccggctttgtacagggcaataaagtgccgggt
tatctggaagaggaaggcgcgaataagaatagcaataccgaaacatttgtgtctattcgg
gtggatatcgatgactggcgttgggctggggtacctttctacctgagaaccggtaagcgc
ctacccagcaaatgctctgaagttgtggtttactttaagaaccccgcactgaatctcttc
cgcgaatcttatcaacaactgccacaaaacaaactgacaattcgtctgcaaccggacgaa
gggatcgaaattgaagtgctgaataaagtccccggattggaacataagcatcgtttacaa
accactaagcttgatctcagtttctccaaaaccttcaatgagcagcatattgctgatgcc
tatgaacgtctgctactggagaccatgcggggtattcaagcgctgtttgtgcgccgtgat
gaggtcgaagaggcgtggaaatgggtcgattctattatgaatgcgtgggcggcagataat
gaagcaccaaaaccataccagtccggtacatgggggcctgtggcatccgttgctatgatc
acccgtgatggccggtcatggaatgagttcgagtaa

DBGET integrated database retrieval system