KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_1001
Entry
YPDSF_1001        CDS       T00505                                 
Name
(GenBank) phage tail assembly protein
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
SSDB
Motif
Pfam: Lambda_tail_I
Other DBs
NCBI-ProteinID: ABP39401
Position
complement(1137877..1138497)
AA seq 206 aa
MTLFAQEVMTPIKLSGSLAKMFGRDHQRLVGSSGEVIKALCVTIPGFEQYLMTAKQRGLT
FAVFKNKRNVGKDELELASGGQEIRIVPVIIGSKRGGLFQTILGVALIGMATFMSGGLAV
AFGAGGVWGGAMAMMGASMALGGVIQMLSPQQSGLAMRQSPDNKPSYAFGGPVNSTAQGN
PVGVLYGKRRIGGAVISAGIYAEDQM
NT seq 621 nt   +upstreamnt  +downstreamnt
atgactttatttgcgcaagaagtaatgacaccaatcaaactaagcggttcattagctaag
atgttcggtcgcgaccatcaacgattagttggtagctctggcgaagttattaaggcttta
tgcgtaactattcctggctttgagcaatacctgatgacggctaagcagcgtggactcacg
tttgctgtattcaaaaataagagaaatgtcggcaaggatgagttggagcttgcaagtggt
ggacaagaaattcgtattgttcctgtaattatagggagcaaacgcggtgggctgttccag
accatactcggcgtagctttaatcggtatggcaacatttatgagtggaggcttggcggtg
gcgtttggcgcgggtggagtatggggtggtgcaatggcaatgatgggcgcatccatggcc
cttggcggcgttatccaaatgctatcaccgcagcagagtgggttagccatgaggcaatca
ccagacaacaagccaagctatgcattcggcggcccggttaactctacggctcagggtaac
ccggtgggcgtactctacggcaagcgtcgaattggcggggcggttatctcggcgggtatt
tatgctgaagatcaaatgtaa

DBGET integrated database retrieval system