KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_0195Help
Entry
YPDSF_0195        CDS       T00505                                 

Definition
(GenBank) hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_0195
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25 RdRP_4
Motif
Other DBs
NCBI-ProteinID: ABP38614
Position
213865..214305
Genome map
AA seq 146 aa AA seqDB search
MAALLNWDRGSSASLFDRIQGKGASSSSDGRLRELLNSIQKHLNEVLNSRPGACQSAVDL
GVIDLNDATATSSDFRKSIEKAIKDCIENYEPRISAVTVQSLLNHGDPLQLSFHISARVN
FDDMGDVVEFNIQLDNNRRYCFNQET
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcttcttaattgggatcgagggagttctgccagtttgtttgaccgcatacag
gggaagggcgctagctcttcctccgatggccgtctgcgtgagctattgaattcaatccaa
aagcatttgaacgaggtccttaactctcgtccaggtgcttgccaaagtgcggtcgatctc
ggggttatcgacctcaatgatgcgaccgccacctcatctgattttcgaaaaagtattgag
aaagccattaaggattgtatcgagaactacgaaccccgaatttctgccgttacagttcaa
tccttgctgaaccatggcgacccactgcaactgagtttccatattagcgctcgtgttaat
ttcgacgatatgggtgatgtcgttgagttcaacattcagttagacaataaccgccgttac
tgctttaaccaggaaacataa

DBGET integrated database retrieval system