KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_0199
Entry
YPDSF_0199        CDS       T00505                                 

Definition
(GenBank) hypothetical protein
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABP38618
Position
216826..217569
AA seq 247 aa
MHRGHGREYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSDESKLVLA
EENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLL
SNMSLNYMSLLDKDALKQILHTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGLP
VRGLQTTLWLEQGAFSSEGELYLFSTVLARFFSLYASVNAFHLLKVINLDNQECYEWPVQ
TGQHALM
NT seq 744 nt   +upstreamnt  +downstreamnt
gtgcaccggggtcatggccgggagtacacctcgtttgagagcttccaccatcagatcgaa
cactcgcaagaaaagaccgcactttattaccgcctacgtgtgaaaaattcattattccgt
aagggattcgaacactacatttcctttgttcgcagtgatgaatcgaagctggtgcttgct
gaagagaatgtctcggtcagcctgacgtgcaccaaccgtgagttgccgctgtcgttgcgc
gttggtgatatcaatcaactcagcacagacagcccttcattcgcgacgttccgcaatatt
acccgtccttccgtgccgttgtatccggtgctggatgggggcctgcattggtcattgctc
tccaatatgtcgttgaactacatgtccttactggataaggacgcgttgaagcaaattctg
catacctatgatttcccaagcctgcataaccggcaatcagccagggcatcgcaaaagaaa
ctggacgctatccaacgtattgaaacacaaccgattgaccggttgtttcgtggcttacct
gtcagagggctacaaaccacgctatggctggagcaaggcgcttttagctctgaaggcgag
ctttatctcttcagcacggtattagctcgcttcttctcactgtatgccagcgtcaatgcg
tttcatcttttaaaagtcatcaatcttgataatcaggaatgttacgaatggccggtacag
acaggtcaacatgcactgatgtaa

DBGET integrated database retrieval system