KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_0202Help
Entry
YPDSF_0202        CDS       T00505                                 

Definition
(GenBank) lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPDSF_0202
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_0202
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_0202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: ABP38621
Position
220063..220608
Genome map
AA seq 181 aa AA seqDB search
MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQATDQPSTVRLTLLSD
PDTNPNEKGEAVPTEIVVVYLSENSKLLAADYDQLSSDALEKTLGKNYIDHQEYTLLPDQ
FKALDPIKLEEKNSYLGVIAHYADANRSEWKKIIKIKGIGHNYQVLVHVRSNDVDLRKEE
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgccagaggctatctcctgacgtgggcattatgtgtggtgttcctgttgtct
gggtgcagcggtgcatgggaagccactaaaaaggtcggcaaggtggttatggaccctgat
attccggtggggcaggctaccgatcaaccctcaacggtcaggctaacattgctgtccgat
cccgataccaaccctaatgaaaaaggggaagcggtaccgactgagatagtggtggtgtac
ctaagtgaaaactccaagctgctggccgcggattatgatcagctaagcagtgacgcgttg
gagaaaacgctgggtaagaattacatcgatcatcaggaatacaccttactgcccgatcaa
ttcaaggcgctggaccctatcaagctggaagagaaaaacagctatctgggggtgattgct
cactatgccgatgccaaccgcagtgaatggaagaagatcatcaaaataaaagggatcggc
cataactaccaggttttggtccatgtcagatcaaacgatgtcgatctaaggaaagaggaa
gaataa

DBGET integrated database retrieval system