KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_0210
Entry
YPDSF_0210        CDS       T00505                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_0210
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_0210
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: ABP38629
Position
231890..232672
AA seq 260 aa
MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLIESLALTLFRTHGVDL
QTAVYYTLARTQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQARSEILEWFNTRVSNQL
RQHDFTRDDLRLVYRAERALQLLYDKLQPVELKRVPRIENLLYLMQNTAKKLESASDAAK
AQQTAAPLKMPPMVYLSVPEAEPVRTAAAAPEPAANIEVRSPPRRLNGGRCCGALVPVSC
VVYWWRLRFTLPSSNRCNSK
NT seq 783 nt   +upstreamnt  +downstreamnt
atgagtgacaccccgcaacatatcatcattaaaaccggcactgacccacggaaccggccg
gaatttaacgccattcgtgaagagatcaacaaaatcaaccacccggcacggccagaggtc
aactggggtttgattgaatcactggcgctgaccctgttccgcacccacggcgtggatttg
cagacggcggtgtattacacgctggcccgcacccaaaaaaatggcctggccggtttcacc
gagggctgcgagttgctggccggtatggtagtcggccagtgggatcacctgtggccggaa
cagccgcaggcacgcagtgaaatactggaatggttcaatacccgcgtcagcaatcaactg
cgtcagcatgattttacccgtgacgatctgcggctggtgtaccgcgccgagcgggccttg
cagttgctgtacgataaattgcaaccggttgaattaaaacgggtaccgcgcattgaaaac
ttgctgtacctgatgcagaacaccgccaaaaaactcgaatcggccagtgatgcggcgaag
gctcagcaaaccgcggccccgctgaaaatgccgcctatggtctatctctcggtacccgag
gccgagcctgtccggacggcagcggcagcccctgagcctgcggccaatattgaggtgcgt
tcgcccccccggcgactaaacggggggcggtgctgtggggctttggtgccggtgtcctgt
gtagtttactggtggcgactgcggtttacgttacccagttcaaaccgctgcaacagcaaa
tga

DBGET integrated database retrieval system