KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_0212
Entry
YPDSF_0212        CDS       T00505                                 

Definition
(GenBank) Rhs accessory genetic element
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPDSF_0212
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_0212
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_0212
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Ribosomal_L5e
Other DBs
NCBI-ProteinID: ABP38631
Position
233224..235614
AA seq 796 aa
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQA
AEVAKTALDAKAKVLDGGVTPTNIVATGPAPTVSGAQMTEMAGGIGDAVGGTAGKRINQA
AEVAKTALEAKAKVLDGGVTPMNLAAGGAGAGLPDSAAAAVKQPSGLQFTLTTASLPPQT
FAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGMVASF
EQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVEEIITTLLKENGINDFAFGFRHP
HPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDVGSLPKGASLPYNPN
VAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEHFDFP
GRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAWQLLG
IQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEE
IYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGD
PDQPIVTGRTYHANNIPPGSLPASKTQMAFRSKTHKGEGYNEMRFEDAKGGEGLFMHAQK
DMTTMVLNDRKTDVTQDHSEHIGQDQSVTVVRNQSNTIQNDRRVEVTRDQQTEVGNDYQL
VVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQGDISISTPNAGITITHDGAIVLQG
KYIRLAADMIDLNPEE
NT seq 2391 nt   +upstreamnt  +downstreamnt
atgtttgctcatgataaagctaataataataaagccgcggacaagaccggcacggtgacg
ccgacccatatcgtctcgccggaggccgccccaaccgtgagtggcgctcagatgaccgag
atggccggggggattggggatgcggtgggcggcactgccggtaagcgcatcaatcaggcc
gccgaggtggcaaaaaccgccctggatgccaaagcaaaagtactggacggcggcgtcacg
ccgacgaacattgtggccactggcccggccccaaccgtgagtggcgctcaaatgaccgag
atggccggggggatcggggatgcggtgggcggtactgccggtaagcgcattaatcaggcc
gccgaggtggctaaaaccgccctggaggccaaagcaaaagtactggacggcggcgtcacg
ccgatgaatctggccgcgggcggggccggtgcgggattgccggacagcgccgcggcggcg
gtcaaacagccctccggcctgcaatttaccctgacgacggccagtttaccgccccagacc
tttgcggtggtggatttcaccctgagcgagatgctctcctcgccgtttgtgctcaatgtc
gggctggcgagtgccgatccggcggtggattttgcggcggtattggatgaagacgccacg
ctgtttatctggcgcgaaggggtactgcaacgcagcatcaccggcatggtcgccagcttt
gaacagggcgataccggttttcatcagacccgctacagcatggtgatccgcccggcgctg
tggcgcaccagcctgcggcgcaatgcccgcatcttccagcaagcctcggtggaagagatc
atcaccaccctgctgaaagagaacggcatcaacgattttgcttttggttttcgccacccg
cacccggtgcgcgagttctgcgtgcaatatcaggagtccgattttgattttatccagcgc
ctgacggcagaagaggggattttctactacttcgagttcagcgccgggaaaaataccgtg
gtgtatgccgatgatgttggctccctgccgaaaggcgcgtcactgccctataacccgaat
gtggcggcgcaggcgcaggaactgagtatcaccaccttcacccgcagtgcgcaggtgcgc
ccggcgatggtgcaactgaaagactacacctttaaaaacccgaactgggccgcggccttc
agcgaacagtcgggagaactgcaaaaccagcgaccggactacgagcattttgattttccg
gggcgcttcaaagatgcccagcacgggcaggattttacccgctaccggctggacgcgctg
cgcaatgacgccaatctggggcagggggccagcaatgattttaccctccagccggggcag
ttgttcagcctgtacaaccacccgcgtggtgatctgaaccacgcctggcagttgctcggt
attcagcacagcggcaaacagatgcaggcgctggagcaggcatctggcgatcagggcacg
gtgctgttcaaccacttcagttttattccgcacacccagacctggcggccgacgccgttg
gctaaaccggcgatggacggcccgcagatcgccatggtggtggggccgccgggggaagag
atttactgcgacgaatacggccgcatccgcctgcaatttttatgggatcgctacgggcag
agcaatgacaacagctcctgttggatccgggtaacccagccgtgggcgggccagggctgg
ggcatgctggccattccgcgtattggtcaggaagtggtggtggattttctgcacggcgat
ccggatcaaccgattgtcacggggcggacctatcacgccaacaacatcccgccggggtcg
ttaccggccagtaaaacccagatggcgttccgctcaaaaacccacaaaggggaaggctac
aacgaaatgcgcttcgaggatgccaaaggcggcgaagggctgtttatgcatgcgcagaaa
gatatgacgaccatggtgctgaatgatcgcaaaaccgatgtgactcaggaccattcagag
cacattgggcaagatcagtccgtgacggttgtgcgtaaccaaagtaatacgatccaaaat
gatcgccgggtagaggtgactcgcgatcaacaaaccgaagtgggcaatgattaccagcta
gtggtgaaaggtgaaaagaaagagtttgtgacgaaaattcgttacaccgaagtgcatgaa
gacgaaacgctcacggtgacgaaaagtattaaaatccatgccaaacaaggtgatatcagc
atatcaaccccgaatgccggaattacgatcacccatgacggtgccattgttctgcaaggg
aaatacattcgtttagcggccgatatgatcgatcttaatccagaggagtag

DBGET integrated database retrieval system