KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_0214
Entry
YPDSF_0214        CDS       T00505                                 

Definition
(GenBank) hypothetical protein
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
SSDB
Motif
Pfam: RHS_repeat PAAR_motif
Other DBs
NCBI-ProteinID: ABP38633
Position
236071..238935
AA seq 954 aa
MFEAARVDDKLYHSSALAGFIIGSIIGAAVIFAAAAYAASIVLTGGATLVATGFIVGMGV
TTLGVVAGGLIRSVGEKIGSMCHHDVGQITTGSKNVKVNSKRAAHVELSTVACKDDSAIQ
RMAEGSSNIFINSKAAVRLEDKTTCDAVVDSASSNVTFGGGRVQYLDIKREISDEMRDLS
EKLFIVAGLAGGIFGAAKQAGCFGLKCLSKIALGEMAGAAAGYGLEKGVGAIAGYFGYPV
DVISGQKLLTGEGDDTDFILPGIFPLHWSRIYRSENHHVGALGQGWSLVWERSLRKEDDS
IVYQNDEGREIVFPLIKRGERYFSPTEHIWLARTERDTYAISSPFETCFIFEAFSEAGVA
KLASLEDLNGHALYFSYDDIGQLKKISTTSGYGVYCQYEKGRLVSVACVKGGTPGTLVRY
QYNEQHQLVSVTNREGQITRQFGYHGHLINKLADVRGLECRYTWADIGGTPRITHSATNL
GEQWQFDYDIDNQQTTLTDLNTGQTACWGYNAQHLITDYRDFDGGKYAFDYNDLNMPVRV
VLAGERTLVLVYDALARPIQITDPLKRETHIDYHRNSLRVVRRQYPDGQVWKGEYDRTGR
LLKENAPDGGVTLYHYPGASSLPERITNAVGAQTHLGWERHGQLTEHTDCSGKLTRYEYD
IDGHLLTVIDAENHSTHYSYNRLGQPTGIRYADGRKEQLRYNAQGLVEQFTDPVGRQLHW
RYNLRGQPVSFTDRLQREYRYRYDCHGQMIELDNANGGQYHFRWSSGGQLVEEQYPDNLV
RRYRYGESGMLMALETTAPTVDDLTVSRQVSFDYDAGGRMTQRLTGMSATRYDWDIMDRL
LLAERVPTAVGEQAGIVGHGVRLAYDKAGHLLTESGDLGAVTYQWDPLHHLAALTLPDGQ
TLSWLRYGAGHVSAIRHGDTLISEFSRDNLHREVSRTQGILTQYRDYDAMGRRL
NT seq 2865 nt   +upstreamnt  +downstreamnt
atgtttgaagcggcccgtgttgatgacaagctttatcattccagtgccttagcgggtttt
attattggctccattattggtgccgccgtgatttttgcggccgcggcttacgccgcctcc
attgttctcaccggcggggcgacgctggtcgctaccggctttattgtgggtatgggggtg
accacgctgggcgtcgttgccggtgggttaatacgctccgtgggcgaaaaaatagggagc
atgtgccatcacgatgtcggacaaattacgacagggtccaaaaacgttaaagtgaacagt
aaacgggcggcgcatgtcgagctcagtaccgtggcctgtaaagatgactccgccattcag
cgcatggccgaaggttcgtcaaatatctttattaacagtaaagccgccgttcgtctggaa
gataaaacgacctgtgatgcggttgtcgattccgcttccagtaatgtgacgtttggtggg
gggcgcgttcagtatctcgatattaaacgcgagatttctgatgaaatgcgtgatttgtca
gagaagctgtttattgtcgccgggctggcgggcggcatatttggggcggcaaaacaggcg
gggtgtttcggccttaaatgcctgagcaagattgcgttgggtgagatggccggggcggct
gccgggtatgggttggaaaaaggggttggggccatcgccggttatttcggttacccggtt
gatgtgatcagtggacagaaattgctgacaggtgagggcgatgataccgattttattctg
ccgggtatcttcccgctgcactggagccggatttatcgcagtgaaaatcaccatgtcggg
gcgctgggacaaggctggtctctggtatgggagcgttcattacgcaaagaagatgacagc
attgtttatcagaatgatgaaggtcgggagattgtctttcccctgattaaacgtggagag
cgctatttctcccccacggagcatatctggctggcacgtaccgagcgtgatacctatgcc
atcagcagcccgtttgaaacctgttttatttttgaggccttttctgaggctggcgttgcg
aaattagccagcctcgaagatctcaatggtcatgccctgtatttctcttatgacgatatc
gggcaactgaaaaaaatatcgaccaccagcggttatggggtgtattgccagtatgaaaaa
gggcgtctggtgtccgttgcctgcgtcaagggcggtacgccgggcacactggtccgctac
cagtataatgaacagcaccagttggtcagcgtcactaaccgtgaggggcaaatcacccgc
cagtttggttaccatggccatctgatcaataaactggcggatgtcagggggctggagtgc
cgttacacatgggctgatatcggcggaaccccgcgaattacgcacagtgccaccaatctg
ggggagcagtggcagtttgattatgatatcgacaatcaacagaccaccctgacggacctc
aataccgggcagaccgcctgctggggatataacgcccaacatttaattaccgactatcgg
gattttgatggcgggaaatatgcatttgactacaacgacctcaatatgccggtacgcgtt
gtgctggcaggcgagagaacgctcgttctggtttacgatgcactggcgcgcccgatccag
atcaccgatccgctaaaacgtgaaacccacattgattatcaccgtaacagtctgcgggtg
gtgcgccgtcagtaccctgacgggcaggtctggaagggggaatatgaccgtaccggccgt
ttgctgaaagagaacgcgccggatggcggggtgacgctttatcattatccaggggcctca
tcccttcctgaacgcataaccaatgccgtaggggcgcagacacaccttggttgggaaagg
cacgggcaactgacggagcacaccgactgctcgggtaaactgacccgctacgaatatgat
atcgatggccatctgctgacggtcatcgatgctgaaaaccattcaacacattacagctac
aaccgtctcgggcagcccaccgggatcaggtacgccgatggccgcaaagagcagttgcgg
tataacgctcaggggctggttgaacagtttaccgatcctgtcgggcggcagttgcactgg
cgttataacctgcggggtcagccggtcagctttactgatcgtctgcaacgggaataccgt
taccgctatgactgccatgggcagatgattgagctggataatgccaatggtggccagtat
cacttccggtggagcagtggcgggcaattggtggaagagcagtatcccgataaccttgtc
cggcgttatcgctatggggagagcgggatgctgatggcgctggagaccaccgcgcccacg
gttgacgatcttaccgtctcccggcaggtcagttttgactatgatgcgggcgggcgaatg
acgcagcgcctgacgggcatgagtgcgacccggtatgactgggacatcatggaccgttta
ttgctggccgagcgtgtgccaacggcggtgggcgaacaggcggggatcgtcggtcatggt
gttcgtttggcgtatgacaaggccgggcatttactgacggaaagcggtgacctgggtgcg
gtgacgtatcagtgggatccgctgcatcatctggccgccctgacgctgcccgatggtcag
acgctgtcatggttgcgttacggtgcgggccatgtcagtgccattcgtcatggtgatacg
cttatttccgagttcagccgggataatcttcatcgggaagtgagccggacccagggtatt
ttgacgcagtatcgtgattatgacgcgatggggcggcggttgtag

DBGET integrated database retrieval system