KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_0220
Entry
YPDSF_0220        CDS       T00505                                 

Definition
(GenBank) Rhs accessory genetic element
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPDSF_0220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_0220
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_0220
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C gpW
Other DBs
NCBI-ProteinID: ABP38639
Position
242211..244409
AA seq 732 aa
MFAHDKANNNKTADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQA
AEVAKTALDAKAKVLDGGVTPLNLAAGGAGAGLPDSAAAALTRLVKQPSGLQFTLTTASL
PPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGM
VASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVEEIITTLLKENGINDFAFG
FRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDVGSLPKGASLP
YNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAW
QLLGVQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGP
PGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDF
LHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFRSKTHQGEGYNEMRFEDAKGGEGLFM
HAQKDMSTTVKDNQTTTVEKGNQTVTVEKGDRTVTVATGNETTDITQGSLTETIKVRRST
CANFIQVKAEGDAPGTQLYTATEQIKFVVGKSSITLNPDSIILQFSGSTSITLNAANIDA
IAPLINLNKDKG
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgtttgctcatgataaagctaataataataaaaccgcggacaagaccggcacggtgacg
ccgacccatatcgtctcgccggaggccgccccaaccgtgagtggcgctcagatgaccgag
atggccggggggattggggatgcggtgggcggcactgccggtaagcgcattaatcaggcc
gccgaggtggctaaaaccgccctggatgccaaagcaaaagtcctggacggcggcgtcacg
ccgctgaatctggccgcgggcggggccggtgcgggattaccggacagcgccgcggcggcg
cttacccgcctggtcaaacagccctccggcctgcaatttaccctgacgacggccagttta
ccgccccagacctttgcggtggtggatttcaccctgagtgagatgctctcctcgccgttt
gtgctcaatgtcgggctggcgagtgccgatccggcggtggattttgcggcggtgctggat
gaagacgccacgctgtttatctggcgcgaaggggtgctgcaacgcagcatcaccggcatg
gtcgccagctttgaacagggcgataccggttttcatcagacccgctacagcatggtgatc
cgcccggcgctgtggcgcaccagcctgcggcgcaatgcccgcatcttccagcaggcctcg
gtggaagagatcatcaccaccctgctgaaagagaacggcatcaacgattttgcctttggt
tttcgccacccgcacccggtgcgcgagttctgcgtgcaatatcaggagtccgattttgat
tttatccagcgcctgacggcagaagaggggattttctactacttcgagttcagcgccggg
aaaaataccgtggtgtatgccgatgatgtcggctccctgccgaaaggcgcgtcactgccc
tataacccgaatgtggcggcgcaggcgcaggaactgagtatcaccaccttcacccgcagt
gcgcaggtgcgcccggcgatggtgcaactgaaggactacacctttaaaaacccgaactgg
gccgcggccttcagcgaacagtcgggagaactgcaaaaccagcgaccggactacgagcat
tttgattttccggggcgcttcaaagatgcccagcacgggcaggattttacccgctaccgg
ctggatgcactgcgcaatgacgccaatctggggcagggggcgagcaatgattttaccctc
cagccggggcagttgttcagcctgtacaaccacccgcgtggtgatctgaaccacgcctgg
cagttgctcggcgttcagcacagcggcaaacagatgcaggcgctggagcaggcgtctggc
gatcagggcacggtgctgttcaaccacttcagttttattccgcacacccagacctggcgg
ccgacgccgctggcgaaaccggcgatggacggcccgcagatcgccatggtggtggggcca
ccgggggaagagatttactgcgacgaatacgggcgcatccgcctgcaatttttatgggat
cgctacgggcagagcaatgacaacagctcctgctggatccgggtaacccagccgtgggcg
ggccagggctggggcatgctggccattccgcgtattggtcaggaagtggtggtggatttt
ctgcacggcgatccggatcaaccgattgtcacggggcggacctatcacgccaacaacatc
ccgccggggtcgttaccggccagtaaaacccagatggcgttccgctcaaaaacccaccaa
ggggaaggctacaacgaaatgcgcttcgaggatgccaaaggcggcgaagggctgtttatg
catgcgcagaaagatatgagtaccacggtaaaagataaccagacgacgacggtggagaaa
ggtaatcaaaccgtcaccgtagaaaaaggtgacaggacagtcacggtcgcgaccggaaat
gaaaccacagatattacccaagggagcctgaccgagacgatcaaagtgcgtcgcagtacc
tgcgcgaattttattcaggtgaaggctgaaggtgatgcgcctggtacgcaactttatacc
gcgacggaacagataaagttcgtggtgggcaagagcagcattaccttaaatccggactct
attattctgcaattttctggctctacctctattacgctgaatgccgccaatattgacgcc
atcgcgccattgattaacttaaataaagacaagggataa

DBGET integrated database retrieval system