KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_0222
Entry
YPDSF_0222        CDS       T00505                                 

Definition
(GenBank) membrane protein
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
SSDB
Motif
Pfam: RHS_repeat PAAR_motif RHS DUF4595 MmcB-like
Other DBs
NCBI-ProteinID: ABP38641
Position
244879..249417
AA seq 1512 aa
MTVAQSIGTGYGAAGAQSALRQTALGQQSPARTDYQVSNPNVGNIARASDSLLNVAESQQ
FNTLVTAGFGMQAIAAGVAGGYVGAKIGNKLGHGIARALNFNQVATEGESPAHLGHPIAH
QKKDWGVWGAIGGILLGAAAAALVVVTFGTGLVVIAAAAAAAGLIGGIAAATGAALGQYG
DNKGVIAEGSANVFFEGQPVARVGDKIQCSDHPSSPPPMIAEGAKTVFANQKQIARLGHR
TTCDGNINAGCGSLAITQETAYVYEVADSRNPYLRWSAVILSFLPIQKKFEQGFRSLKKP
PNTAVNATHNCPTGSDPVDMVSGDYLQVWPVIDIAGVLPVRLQRTYRSGDYFTVSGCFGH
KWADSWSQHLVVHEDNIDYIDEEGVGLSFFTPENKVQAVNLYNLRYELVGERHGELRVFD
RSTQQTLHFNQQQQQQRYLSAITDRKGNRIDFRYQQGELISVEHSDGYVLEIDSRGRTIH
AVELVTQEKRQKLLQSTFSERGYLVQCQSFQYGTLSHEYDPKGYMVRWRDTDSTDVAVRY
DISGRVVALKTSTGFFADHFIYHDKERYTIYRDGEGGETGYHYNENNLLIKLVDPLGNTT
LTDWDLTQKIKETDALGRITRFIYNERGDLTAVILPDETRTEYEYNPSGVVTAFTSSAGD
SWQYQYDRQGLLRQVTYPSGQTMSFRYGKKGEVLRKIIAEDQVWRYHYDHHGCLSTIIDP
KGNSTAVTLDVLGRLFSHQNALGELTRYTHSDAHASPAGSVTKMVMPDGVEQAIAYDSEK
RIAALTDGAGKTTRYEYGGFDLLTGLIRPDGQRLTFGYDTLTRLNQVTNASGDTYRYTRD
RAGQVISETDFTGRTVHYQYDAVGRRIGARYPDQRLVRWHYSMQDQVLAQQTWHCDALSS
TLVGTVSYGYDGAGRLLSATNADAVVEFDYDEAGQLVAERLNGREVRHQWDALNGTPVAR
QVGELGLTFVYGAQGELTRLQLAGHQPLQLQHDRLGRETVRESAAGFIQACNYTPSGLLA
HQAAGRNSALFQQQLIAPESPALHGSAVNRSWQYDRAYNVVGMDDGRWGKTQYQYDRNDQ
VVRADFGGFLPLQEQFSYDVNQNLREHRCLPRGAQAVLAQASQQQQAGRVVKRGDSQYRY
DAAGRLVEKRSQKDGYRPQLWRYRWNEQDQLSELITPTGARWRYGYDAFGRRIRKLRVVD
TPPLNEMDAPSTGPATASLAGYAYLWSGDQLIEEVPVYADGTVAYEQGIHWLYAPGGLTP
MARYAQGKLHYVVADHLGTPRELLNEQGKVVWASRLSTWGQAELWRQAANEEDRVSCNLR
FAGQYADAESGLHYNRFRYYDGETGQYLCPDPIGLEGGLNPYGYVHNPVSWVDPLGLATC
PMREVNGTKIFGKGQKDGTPGHDQFSEVIANKLAMSGKFKEVYLNRSYNFANGKGISGRR
PDIMAVDMNGKVHAIELASKTDMGRKFPSLRTRNQDAMKNLPSIDRGSVIVLEHQYNSSK
IKNALDNLISGI
NT seq 4539 nt   +upstreamnt  +downstreamnt
atgactgtcgcacaaagtattggcaccgggtatggcgcggctggcgcgcaatcggcatta
cgtcaaaccgcgctggggcaacagagcccggcgcggacggattatcaggtcagtaatccc
aatgtggggaatatcgcgcgagcgagtgattctctgctgaatgtggcggaaagtcagcag
tttaacactctggtgaccgccggttttgggatgcaggcgattgccgccggggtggccggg
ggatatgtcggtgccaaaatcggcaataagttaggtcacggtattgcccgtgcgcttaat
tttaatcaagtggcgacggaaggagaaagccccgcgcacctgggccatcccattgcccat
cagaaaaaagattggggggtgtggggggccattggcggtattttactgggggcagcggcg
gcggcattggtggtcgtcacctttggtacggggttggtggtgattgccgcggcggcggcc
gcagccgggttaatcggcggtatcgccgccgcgaccggggcggcattaggacaatacggt
gataacaaaggcgtgattgctgaaggctccgccaacgtcttctttgaaggccagccggtg
gcccgggtgggggataagatccaatgcagcgatcaccccagttcaccgccgccgatgatt
gccgagggcgcaaaaaccgtatttgccaaccaaaagcagatcgcgcgtctggggcaccgt
accacctgcgatggcaatatcaatgcgggatgcggttcgctcgccatcacgcaggaaacg
gcttatgtgtatgaagtggcagacagccgtaatccgtatttacgctggtcagcggttatt
ctgagtttcttgccaatacagaaaaaatttgagcaagggtttcgctccttaaaaaagccg
cccaataccgcggtcaacgctacccataactgcccgaccggcagtgatcctgttgatatg
gtctccggcgattaccttcaggtctggcccgtgattgatattgccggtgttttgcctgtc
cggttacagcgtacttatcgttccggcgattatttcacggtctcgggttgctttggtcat
aaatgggcggatagctggtcacaacacttggtcgtgcacgaagacaacattgattacatt
gatgaggaaggggtggggctgagcttctttacgccagagaataaagtccaggccgtcaat
ctgtataacctgcgttatgagttagtgggggagcgtcatggcgaactcagggtttttgac
cggtcaactcagcagacactgcattttaatcaacagcaacaacagcagcgttatttatcg
gctatcaccgaccgcaaagggaaccgaatcgattttcgttaccaacagggggaactgata
tcggtcgagcacagtgacggctatgtgctggagatcgacagccgtggcaggacaatacac
gcggtcgagcttgtcacgcaggagaaaagacaaaagctgttgcagagtacattcagtgag
cgcggttacctcgttcagtgccagagtttccagtatggcacgctgtcgcatgaatatgat
ccgaaggggtatatggtgcgctggcgggatacggatagcacggatgtggctgtccgttat
gatatttcagggcgggtggtggcactaaaaacatcgaccggtttttttgccgaccatttt
atttatcatgacaaagaacgctatacgatctatcgcgatggggaagggggagaaaccggt
tatcactataatgaaaacaatctgctgataaagttagtcgatccgttaggcaataccacc
ctcaccgactgggacttgacccagaaaataaaagaaaccgatgcattagggcgtatcacc
cggtttatttacaatgagcgcggtgatttaaccgccgtgatcctcccggatgaaacccgt
accgaatatgagtataacccgtctggcgtggtcactgcgtttacgtcttcggcgggggat
agctggcaatatcagtatgacaggcagggattgttacgacaggtaacttatccttccggc
cagacgatgtcgtttcgctacggcaagaagggagaagtgctgcgcaagatcatcgcggaa
gatcaggtgtggcgttaccactatgatcaccacggttgtttaagcaccattatcgatccg
aaggggaacagtacagccgtcacactggatgtgctggggcggttattttctcaccaaaac
gccctcggggagctcacccgttacacacacagtgacgcgcatgccagtccggcgggcagc
gtcacaaaaatggtcatgccggatggtgtggagcaggccattgcctatgacagcgagaag
cgtattgccgcgctgaccgatggcgcggggaaaaccacccgttacgaatacgggggtttt
gatttactgaccggcctgatacgcccggacgggcagcggctgaccttcggctatgacaca
ctgacgcgcctgaatcaggtgaccaatgcgtcaggtgacacctatcgttatacccgtgat
cgggccgggcaggtgatcagcgaaaccgattttaccgggcgcacggttcattatcagtat
gatgcggtggggcggcgtatcggggcgcgttacccggatcagcgccttgttcgctggcac
tactcgatgcaggatcaggtgctggcgcagcagacctggcactgcgatgcactgagttcc
acgctggttggcacggtcagctacggttatgacggtgccggtcgtttgctgagcgcgacc
aatgcggatgcggtggtggagtttgattacgacgaggcgggtcagttggttgcggagcgg
ctgaatggccgggaggtgcggcatcagtgggatgcgctaaacggcacccctgttgcccga
caggtgggtgagctggggctgacgtttgtgtacggcgcacagggcgaactgacccggcta
cagctggcgggccatcagccccttcagttgcagcatgaccggttggggcgggagacggta
cgtgaaagcgcggccgggtttattcaggcctgcaattataccccgagcgggctgttggcc
catcaggcggccgggcgtaactcggcattattccagcaacagttgatcgccccggagagc
ccggccttgcacggcagtgcggtcaaccgcagttggcagtatgaccgggcttataacgtg
gtggggatggatgacgggcgttggggtaaaacgcagtaccaatatgaccgcaatgaccag
gtcgttcgcgctgattttggtggttttttgccgttgcaggagcagtttagctacgatgtg
aaccagaacctgcgcgagcatcgctgtttaccgcgtggggcacaggcggttttggcgcag
gcgagccagcaacagcaggcgggccgggtggtgaagcgcggtgacagtcagtaccgttac
gatgctgccgggcgactggtggagaaacgcagccaaaaagacggctaccggccacagctg
tggcgctaccgctggaatgagcaggaccagttatccgaattgatcacgccgacgggggcg
cgctggcgctacggttatgatgcctttgggcgacgtattcgaaaactgcgggtagtggat
accccgccgctcaatgagatggacgctccttccaccggtccggccacggcatcactggcc
ggttacgcgtacctgtggagcggcgaccagttaatcgaagaggtgccggtgtatgccgac
ggcacggtggcgtatgagcaggggatccactggctgtatgcgccgggcggattaacgccg
atggcccgctacgcgcaaggcaaactgcattatgtggtggcggatcatctgggtacgccg
cgggagttgttgaatgagcagggcaaggtggtgtgggcgagccgactgagcacctggggg
caggcggaattatggcgacaggcggcgaatgaggaggatcgggtcagctgtaacctgcgt
tttgcgggtcagtacgcggatgcagaatccgggttgcattacaaccggttccgctactat
gatggcgagacggggcaatatctatgcccggacccgatagggctggaagggggattaaac
ccgtacgggtatgtacataatccggtgagctgggtggatccgctggggctggcaacatgt
ccaatgcgtgaagttaacggaacaaaaatatttggtaaaggccaaaaagatggaactcct
ggtcatgatcagttctctgaagttatagccaataaattagccatgagtggtaagtttaaa
gaggtctatttaaataggtcatataattttgctaatggtaaaggaatctcaggacgacga
cctgacattatggctgttgatatgaatggtaaagttcatgctatagaattggcatctaaa
acagatatgggtagaaaattcccatctctgagaactcgaaaccaagatgcaatgaaaaac
ttaccaagcattgatcggggaagtgttattgtattagaacaccaatataattcttcgaag
attaagaatgcattagataatcttatttctggtatatag

DBGET integrated database retrieval system