KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_0821Help
Entry
YPDSF_0821        CDS       T00505                                 

Definition
(GenBank) mannitol dehydrogenase
  KO
K00007  D-arabinitol 4-dehydrogenase [EC:1.1.1.11]
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp00040  Pentose and glucuronate interconversions
ypp00051  Fructose and mannose metabolism
ypp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YPDSF_0821
   00051 Fructose and mannose metabolism
    YPDSF_0821
Enzymes [BR:ypp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.11  D-arabinitol 4-dehydrogenase
     YPDSF_0821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh
Motif
Other DBs
NCBI-ProteinID: ABP39227
Position
complement(927270..928661)
Genome map
AA seq 463 aa AA seqDB search
MNTDLKSPPAVWLHIGAGSFHRAHQAWYLHRLLASGDDRWTIALANIRDDAIPLLDTLRA
QHGEYVLETVTPSGERQYEKITSLRNIIPWDKALDHLVAQGSKPETRVISFTVTEGGYYL
DNQFNLQQDNSDIQADLRGDCRTIYGAISRILQQRQQDKSGPVTLLNCDNLRHNGERFRH
GLLEFLALRGQQSLLNWVTSQTRSPNTMVDRITPRPSADIAQRVLEKTGIVDNAPVMGES
FIQWVIEDDFIAGRPALENVGAEMVTSVLPYEEAKIRILNASHSCIAWAGSLIGQCYIHE
STQTDAIRQMAYDYVTQDVIPSLTPSPLDLAHYRDVVLERFSNPYIRDTNQRVAADGFSK
IPGFITPTLIECYQRGGVPTATAMLPALFFVFMESWHQGTLPYEYQDGILDPAAVHAMFQ
SSDPAGLFARDSALFGPLANDDQFEQLLRQSINRVSAWVSTNR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgacctgaaatcaccccctgctgtgtggctgcatattggtgctggctccttc
caccgagcccatcaggcttggtatttacaccgtttgttagcctcaggcgatgaccgttgg
actatcgctttggccaatattcgtgatgacgccatcccactactggacacattgcgggcg
caacacggtgaatatgtcttggaaacggtcacaccaagcggtgaacgccagtatgaaaag
ataacatcactgcgcaatatcattccttgggataaagcgctagatcatctggtagcgcaa
gggagtaaacccgaaactcgcgtgatctctttcaccgtaacggaggggggctactattta
gataatcaatttaatctgcaacaggacaatagcgatattcaggccgatcttagaggagat
tgccgcacgatttacggggcaattagccgtatcttgcaacaacggcaacaggataagagt
ggcccggtcactctactgaactgcgataacttgcgtcacaacggtgaacgattccgccat
ggcttattagagtttcttgctctacgaggtcaacaaagcctattaaactgggtgacaagc
cagacccgcagcccgaataccatggttgatcgtatcaccccgcgcccatcagccgatatc
gcgcagcgggtgttggaaaaaaccggtatcgtagataacgctccggtgatgggggaatca
tttattcaatgggttattgaggatgattttattgctggccgcccggcactggagaacgtt
ggggcggaaatggtcacctcggttttgccttatgaagaagccaaaatccgcattctgaac
gccagccacagttgtattgcttgggcgggcagcttgattgggcaatgttatattcatgaa
agtacccaaaccgacgctatccgccagatggcttatgactatgtcacgcaagatgtcatt
ccctccctgacgcccagcccacttgatttagcccattaccgcgatgtggtactggaacgt
ttcagtaatccgtatattcgcgatacgaaccagcgtgtcgccgccgatggattttccaaa
atccccggatttatcactcccacgctgatcgagtgttaccaacgtggcggagtgcctacc
gctaccgcaatgttgcccgcattattcttcgtatttatggaaagttggcaccaaggcact
ctgccgtatgaatatcaggatggtattctggacccagcagccgtccatgccatgtttcag
tcttctgaccctgcaggcttatttgcccgtgatagcgcccttttcgggccgctggccaat
gatgatcagttcgaacagttattacgccagtccataaatcgtgtctctgcttgggttagc
actaaccgttaa

DBGET integrated database retrieval system