KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_1056Help
Entry
YPDSF_1056        CDS       T00505                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp00030  Pentose phosphate pathway
ypp00480  Glutathione metabolism
ypp01100  Metabolic pathways
ypp01110  Biosynthesis of secondary metabolites
ypp01120  Microbial metabolism in diverse environments
ypp01130  Biosynthesis of antibiotics
ypp01200  Carbon metabolism
Module
ypp_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ypp_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ypp_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YPDSF_1056
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YPDSF_1056
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypp04147]
    YPDSF_1056
Enzymes [BR:ypp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     YPDSF_1056
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     YPDSF_1056
Exosome [BR:ypp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   YPDSF_1056
  Exosomal proteins of colorectal cancer cells
   YPDSF_1056
  Exosomal proteins of bladder cancer cells
   YPDSF_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ABP39454
Position
complement(1186741..1188225)
Genome map
AA seq 494 aa AA seqDB search
MAVMNTVQVAQACDLVIFGAKGDLARRKLLPSLYQLEKAGHIHPDTRIIGVGRAEWDKDA
YTAVVKEALDTFMKEPLDDELWQKLSSRLDFCNLDVNDSKHFTKLGKMLDQKHRTTINYF
AMPPSTFGAICKGLGEAGLNKEPSRVVMEKPLGTDLASSRVINDQVAEYFNECQVYRIDH
YLGKETVLNLLALRFANSLFASNWDNRTIDHVQITVAEEVGIEGRWGYFDQAGQMRDMIQ
NHLLQILTMIAMSPPADLSTDRIRDEKVKVLRSLRRIDHTNVRETTVRGQYTAGFVQGNK
VPGYLEEEGANKNSNTETFVSIRVDIDDWRWAGVPFYLRTGKRLPSKCSEVVVYFKNPAL
NLFRESYQQLPQNKLTIRLQPDEGIEIEVLNKVPGLEHKHRLQTTKLDLSFSKTFNEQHI
ADAYERLLLETMRGIQALFVRRDEVEEAWKWVDSIMNAWAADNEAPKPYQSGTWGPVASV
AMITRDGRSWNEFE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaatgaatacagtccaggtagcccaggcgtgtgacctggtgattttcggcgct
aaaggtgatttggctcgccggaaactgctgccttctctttaccaattagaaaaagcgggt
catatccacccagatactcggataatcggtgttggccgtgctgagtgggataaagatgcg
tacaccgctgtggtaaaggaagccctcgatacctttatgaaagagccgctggatgacgag
ctatggcaaaaactcagctcgcgcctcgacttctgcaatctggatgtgaatgacagtaag
catttcaccaaattaggtaaaatgctcgatcaaaaacatcgcaccacgattaactacttt
gctatgccgccgagtacatttggtgcgatttgtaaaggcctgggagaagccgggttaaac
aaagagcctagccgagtggtaatggaaaaaccattgggaaccgatttagcgtcctcaagg
gtaattaacgatcaggtagccgagtatttcaacgaatgtcaggtttaccgtattgaccac
tatttagggaaagaaacggtattaaacctgttggcgcttcgcttcgctaactcgttgttc
gcctcaaactgggacaaccgcactatcgatcatgtgcaaattaccgtcgcagaagaggtc
ggaattgaagggcgttggggctattttgatcaggccggtcagatgcgtgacatgatccaa
aaccatctgttgcaaatcctgacgatgatcgccatgtcaccccccgcagatctcagtacg
gatcgcatccgtgatgaaaaagtaaaagtactgcgttcgctgcgccgtattgatcacacc
aatgtgcgcgaaactacagttcgtgggcaatatactgccggctttgtacagggcaataaa
gtgccgggttatctggaagaggaaggcgcgaataagaatagcaataccgaaacatttgtg
tctattcgggtggatatcgatgactggcgttgggctggggtacctttctacctgagaacc
ggtaagcgcctacccagcaaatgctctgaagttgtggtttactttaagaaccccgcactg
aatctcttccgcgaatcttatcaacaactgccacaaaacaaactgacaattcgtttgcaa
ccggacgaagggatcgaaattgaagtgctgaataaagtccccggattggaacataagcat
cgtttacaaaccactaagcttgatctcagtttctccaaaaccttcaatgagcagcatatt
gctgatgcctatgaacgtctgctactggagaccatgcggggtattcaagcgctgtttgtg
cgccgtgatgaggtcgaagaggcgtggaaatgggtcgattctattatgaatgcgtgggcg
gcagataatgaagcaccaaaaccataccagtccggtacatgggggcctgtggcatccgtt
gctatgatcacccgtgatggccggtcatggaatgagttcgagtaa

DBGET integrated database retrieval system