KEGG   Yersinia pestis Pestoides F: YPDSF_1104Help
Entry
YPDSF_1104        CDS       T00505                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ypp  Yersinia pestis Pestoides F
Pathway
ypp00900  Terpenoid backbone biosynthesis
ypp01100  Metabolic pathways
ypp01110  Biosynthesis of secondary metabolites
ypp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ypp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YPDSF_1104
Enzymes [BR:ypp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     YPDSF_1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C DUF1127
Motif
Other DBs
NCBI-ProteinID: ABP39502
UniProt: A4TJP0
Position
1244478..1245377
Genome map
AA seq 299 aa AA seqDB search
MTTANQPICPSPAKWPSPAKLNLFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQ
IRLLTPIAGVENEQNLIVRAAKMLQKHPGNTPVPRGADISIDKCLPMGGGLGGGSSNAAT
VLVALNLLWQCGLTDEQLADLGLTLGADVPVFVRGHAAFAEGIGEKLQPAEPVEKWYLVI
HPGVNIPTPIIFSDPELKRNTPIRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYA
PSRLTGTGACVFAEFDTESSARQVLSIAPEWLHGFVARGVNVSPLHRVRSGKIESSERR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgcgaatcaacctatatgtccgtcaccagcaaaatggccgtcaccggcaaaa
ttgaatttgtttctttatatcaccgggcaacgcgccgacggctatcatcagttacaaacg
ctgtttcaatttcttgattatggtgatcaactgacgattgaaccgcgcgatgacaaccaa
attcgcttattaacccccatagcaggggtggaaaatgagcaaaacctgatcgtccgcgcg
gcaaaaatgctgcaaaaacaccctggcaatacccccgtgccacgcggtgctgatatcagc
attgataaatgtttaccgatgggcggtggattggggggcggttcgtctaatgcagccaca
gtcttggtggcactcaacctactgtggcaatgtggtttaactgatgaacaattagccgat
ctcggactaacattaggggctgatgtcccggtatttgttcggggccatgccgccttcgca
gagggtattggtgaaaaattacagccagcagagcctgtagagaagtggtatttggtcata
caccccggtgtaaacatcccaacaccgattattttttctgatcctgaattaaaaagaaat
acgccaatccgcccactggcggcgcttttaagcactccatacgcaaatgattgcgaaccg
atcgcaagaaaacgttttcgcgaggttgaacaggctctttcatggctgttagaatacgcc
ccgtcacgccttaccggtaccggcgcttgtgtgtttgcagaattcgacacggagtcatcg
gcccggcaggtgttaagtattgcccctgagtggttacatggttttgtcgcccgtggtgta
aatgtttcaccattgcatcgtgtacgctcagggaaaattgaaagcagtgagcgcagataa

DBGET integrated database retrieval system