KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_1488
Entry
YPDSF_1488        CDS       T00505                                 

Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPDSF_1488
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_1488
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_1488
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ABP39875
Position
complement(1676881..1677462)
AA seq 193 aa
MLTTVWKNKTCTSKHKSWAAWKNKICIPALVLLLSGCGLTQAVTDSTVSATKSLFYKQIK
VLHLDFTAREALNTDAHEANSSSEPVMVRVYQLRDDKTFLKTVYQQLASDGEAALKDDLL
ASRSVVVKPGGAVTLDMPMEKETQFVAVVALFRHPDMAKDHWRLILTLDDLHPDKPRTLE
LGNNSLTLRTEKK
NT seq 582 nt   +upstreamnt  +downstreamnt
gtgttaactaccgtttggaaaaataaaacctgtacttcgaaacataaaagctgggccgcc
tggaaaaataaaatctgcatccccgcactggtcttgttgctcagtggctgcgggctgacg
caagccgtgaccgatagcaccgtgtcggccacaaaatcactgttttataagcagataaag
gtgctgcatctggactttaccgcccgtgaagccctgaataccgatgcgcacgaggcgaac
tcgtcatcggagccggtaatggtgcgggtttatcagttacgtgatgataaaaccttcctc
aaaacggtgtatcaacaactggcaagcgacggggaggcggcgcttaaagatgacctgctg
gccagccgcagtgtggtggtgaaaccgggcggggcggtaacactggatatgccgatggaa
aaagagacccagtttgtggcagtggtggcgctgttccgtcatccggatatggccaaagac
cactggcgtctgatactcacgctggacgacctgcatcccgataagccccgtacccttgag
ttgggtaataacagcctgaccctgcggacggagaaaaaataa

DBGET integrated database retrieval system