KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_1504
Entry
YPDSF_1504        CDS       T00505                                 

Definition
(GenBank) ATPase subunit of ATP-dependent protease
  KO
K11907  type VI secretion system protein VasG
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPDSF_1504
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_1504
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_1504
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small AAA_16 AAA_22 AAA_25 ATPase_2 NACHT IstB_IS21 AAA_7 Sigma54_activat AAA_24 Zeta_toxin AAA_14 Clp_N RsgA_GTPase SRP54 PIN DUF815 Hpr_kinase_C
Other DBs
NCBI-ProteinID: ABP39891
Position
complement(1699170..1701812)
AA seq 880 aa
MTTHSAHLLRRLNPYCAQALAGAATLCQTRAHAEITVEHWLLKLLEQGEGDITVIARRYE
WDMDSLWQGLLSHLDTLPRTVQGKPQLSAALQQLIKNAWLDASLQENADAVRSVHLMAAL
IATPSLLVAEAAWPLLSLSTTQLQRLLPLLDNQSDERPEVQQAAALADSPVNLTDEAATV
TSASGQPQLNDALQAALDKFTLDVTAKARANQIDPIFGRDSEIRQMIDILSRRRKNNPIL
VGEPGVGKTALVEGLALRIADGNVPDSLKTVSVRTLDLGLLQAGAGVKGEFEQRLKNVIE
AVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATTWSEYKQYFE
RDAALERRFQMVKVDEPDDDTACLMLRGLKERYATHHGVHILDAAITAAVTLSRRFLTGR
QLPDKAVDLLDTAGARVRMSIDTLPTALMEINAELAALAMEQQAIEQDLLLLPNVSSTRL
PEIEQRRAALAVGQHTLEQQYKEEKRLTTLIIEARQDIANAAHLVALQEELVQIQGNAPL
LSLDVDVRTVAAVIADWTGVPLGSLLKDEQTNLLSLENRLGERVIGQDAALGALAQRLRA
AKTGLTSENGPLGVFLLVGPSGIGKTETALALADSLFGGEKSLITINLSEYQEAHTVSQL
KGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDVLNLFYQVFDRGFMRDGEGRE
IDFRNTVIVMTANLGSDHLMQLLDEQPDAPDSTLHELLRPILRDHFQPALLARFQTLIYR
PLQVDALKRIVAIKLNQVAQRLHCHYGLSCQIEDSLTDTLVAACLLPDTGARNIDSLLNQ
QILPVLSQQLLSRMSEQQRTTSLTLGWHEEDGITLTFEGE
NT seq 2643 nt   +upstreamnt  +downstreamnt
atgacaacgcattcagcacacttattacgtcggttaaatccctattgcgcacaggcactg
gccggtgccgccaccctgtgtcagacccgcgcccatgctgagatcactgtcgaacactgg
ttgttaaaattgctggagcagggcgaaggcgatattacagtcattgcccggcgttatgag
tgggacatggacagcctgtggcagggattactgtcccatctggacaccttgccgcgcacg
gtacagggcaaacctcagttgtccgccgcgttacagcaactgatcaaaaacgcctggctg
gatgcctcgttgcaggaaaatgctgatgcggtgcgctcggttcatctaatggcagcgctg
attgccacgccgtcattattggtcgccgaggccgcctggccgttgctcagcctgagcacc
actcagctacagcgcctgttaccgctgctggacaaccagtccgacgaacgccctgaggtg
cagcaggctgcggcactggccgacagcccggtcaatctgaccgatgaggccgcgacggtt
acctccgccagtggtcagccgcaactgaatgacgcgctgcaagcggcgctggataaattc
accctcgacgtcaccgccaaagcccgtgccaaccagattgacccgatttttggccgcgac
agcgaaatccgccagatgatcgacatcctgtcgcgccgccgtaaaaacaacccgattctg
gtgggtgaaccgggtgtggggaaaaccgcgctggttgaagggctggcactgcggattgcc
gacggcaacgtaccggacagcctgaaaaccgtcagtgtgcgcacactggatttgggtctg
ttacaggccggggctggggtgaaaggcgaattcgaacagcgcctgaaaaatgttatcgag
gcggtgcaacaatcccccagcccggtgctgctgtttatcgacgaagcccacaccattatc
ggggccggtaatcaggccggtggtgccgatgcggccaacctgctgaaacctgcactggcg
cgtggcgaactgcgcaccatcgccgccaccacctggtccgaatacaaacagtattttgaa
cgcgatgccgcactggagcgccgcttccagatggtcaaagtggacgagccggatgatgac
accgcctgcctgatgctgcgtggcctgaaagaacgttacgccacccatcacggcgtgcat
attctggacgccgctatcaccgcagcggttaccctgtcgcgccgctttctgaccggtcgc
caactgccggacaaagcggtggatcttctcgacaccgcaggtgcgcgcgtgcgcatgagc
atcgacaccttgccgactgcgttgatggagattaacgccgaactggccgcactggcgatg
gagcaacaggccatcgaacaggacttgctcctgctgccgaatgtcagttcaacgcgctta
cctgagattgagcaacgccgcgccgcgctggcggttgggcagcacacactcgaacagcaa
tataaagaagagaagcggttgaccaccctgattattgaggcgcgtcaggacatcgccaac
gcagcacatctggtcgcgttgcaggaggaactcgttcagattcagggcaatgcgccgctg
ttgtcgctggacgttgatgtgcgcactgttgcggctgtgatcgccgactggaccggtgtg
ccgctgggcagtttactcaaagacgaacaaaccaacttgctgtcactggaaaatcgtctg
ggtgagcgagtgattgggcaggatgcggcattaggtgcgctggcgcaacggctgcgggcc
gccaaaaccggcctgacatcagagaatggcccgctgggggtgttcctgctggtcgggccg
agtgggatcggcaaaaccgaaaccgcgttggcactggccgacagcctgttcggcggggaa
aaatcgctgatcaccatcaacttatcggagtatcaggaagcgcacaccgtctcccagttg
aaagggtcgcccccgggttatgtcggttacggacagggcggcgtattaaccgaagcggta
cgtaaacggccttacagcgtggtgctgctggatgaagtggaaaaagcccatcgtgatgtg
ctgaacctgttctatcaggtgtttgaccgggggttcatgcgcgacggtgaagggcgcgaa
attgatttccgcaacacggtcattgtgatgaccgccaatctgggcagtgatcatctgatg
cagttgctggatgagcaaccggacgcgccggacagcaccctgcatgaactgctgcggccg
atcctacgcgaccacttccagcccgcgctgctggcccgcttccagaccttgatttaccgc
ccgcttcaggtggatgcgctcaaacgcattgtggcgataaaactgaatcaggtggcgcaa
cgcctgcactgtcactacggcctgagctgccagattgaagacagcctgaccgacacactg
gtcgccgcctgcctgctgccggacaccggcgcacgcaacatcgacagcctgctcaatcag
cagattttaccggtattgagccagcagctgttaagccgcatgagcgagcaacagcgcacc
acctcgctgacgctgggctggcatgaagaagatggcatcacgctgacatttgagggcgaa
taa

DBGET integrated database retrieval system