KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_1510
Entry
YPDSF_1510        CDS       T00505                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_1510
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_1510
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ABP39897
Position
complement(1706478..1708022)
AA seq 514 aa
MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDE
RVTAAVSVFLDLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWR
GVKSLIDQTDFRQNVRIELLDISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIA
AAISNYEFDRSPQDIALLRNISKVAAAAHMPFIGSVGPAFFGKENMEEVAAIKDIGNYFD
RAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVRSFNYVEQVKGPDHERYLWTN
ASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQVKIPSEVMIPETRE
FEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKLIQRENIGTTKDRRLLELELNNWVRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDN
PGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgtctgtacaggaaaaccgtgcgcagggtactgcgacgaccgtattaaagaatagccct
gcggcacaaggggtttacgccgccttgtttgaaaaaatcaacctgagcccggtctcctca
ctggccggtatcgaggcgttccagaacaacgatgcgctggcggaagccaccaccgatgag
cgcgttaccgccgccgtcagtgtctttttagacctgctgaagcagtcggcgaagaaagta
gaaaaactggataaaaccctgctggacggccatattgccgcactggatgaccaaatcagc
cgccagttggacgcggtaatgcaccaccccgatttccagcgggtggaatcgacctggcgt
ggtgtgaagtcgctgatcgatcagaccgatttccgccagaacgtgcgcatcgagctgctg
gatatcagtaaagatcatctggtgcaggattttgaagatgccccggaaatctcacaaagc
ggtttatacgcccagacctatattcaggaatacgacacccccggcggcgagccgattgcc
gcggctatctccaactacgagttcgaccgcagcccgcaagatatcgccttattgcgcaat
atctccaaagtggcggctgcagcccatatgccgtttatcggctcagtgggtccggcgttc
tttggtaaagagaacatggaagaagtggcggcgattaaagatatcggcaactactttgac
cgcgctgaatacatcaaatggaaagctttccgcgactcggatgattcccgctatatcggc
ctgaccatgccgcgcgtgctggggcgtttgccttatgggccagacaccgtgccggtgcgc
agctttaactacgtagagcaggtgaaagggccggatcatgagcgttatctgtggaccaac
gcttcgtttgcctttgctgccaacatggtgaaaagcttcattaaaaatggctggtgtgtg
cagatccgtggcccgcaggccggtggtgcggtcaccaacttaccgatccacctgtacgat
ctgggtaccggtaatcaggtcaaaattccgtcagaggtgatgatcccggaaacccgcgag
ttcgagtttgccaatctgggctttatcccgctgtcgtactacaaaaaccgcgattactcg
tgcttcttctcggccaactcggcgcagaaaccggcgctgtatgacaccgcggatgccacg
gccaacagccgcatcaacgcccgtctgccgtatatcttcctgctgtcgcgcattgcccat
tatctgaaactgatccagcgcgagaacatcggcaccaccaaagatcgccgtctgctggag
ctagagctgaacaactgggtgcgcgggctggtgacggaaatgactgatccgggtgatgat
ttgcaggcgtcccatcccctgcgtgatgccaaagtgacggtcgaagatatcgaagacaac
cccggcttcttccgcgtcaagctgtatgcggtaccgcatttccaggtggaagggatggac
gtcaatctgtcattggtttcccaaatgccgaaggctaaggcataa

DBGET integrated database retrieval system