KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_2044Help
Entry
YPDSF_2044        CDS       T00505                                 

Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPDSF_2044
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_2044
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN DUF4969
Motif
Other DBs
NCBI-ProteinID: ABP40423
Position
complement(2304896..2305456)
Genome map
AA seq 186 aa AA seqDB search
MILIRLSMNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPND
KGVANPLRIALYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTL
DAGVTAIGIVAAYREIEQAEWKAVIYPLPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSI
SIKEMD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgattttaattaggctaagtatgaataaaagtatccgaggggtttaccgggcgacacag
tacttatttttggtactggtaacgttattgacgatagcctgtagttcaaaagtgcaacct
gaaaaggctgaaaagcttaccgtcgaaatcgcgacagcagcggatattaatccgaatgat
aaaggggtggcgaacccgctaaggattgcactttatacactcaagagcaccgatgaattt
cagtcgagtgatttcttcactatcactgaagaaaatacgccatcgctaaaagaacaaatg
gataacgtgtttgaccggattatgttgccaagcgagaccaaaaaaatagagctgacactt
gatgctggcgttactgctatcggcatcgtggctgcttatcgtgaaattgaacaggcggag
tggaaagcggttatttatccgttgcccaaaaaacgcgtggatccttggtataaaaaaatg
tggccagggcaagaccaacaagatccgatcatgaaggtacgcgttgagcgtctgtcaata
tcaattaaagaaatggattaa

DBGET integrated database retrieval system