KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_2055
Entry
YPDSF_2055        CDS       T00505                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypp02044]
    YPDSF_2055
Secretion system [BR:ypp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPDSF_2055
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABP40434
Position
2318513..2320393
AA seq 626 aa
MDHKFLDYYNKELTFMREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSART
QIKLDAEFPKFTQRLLDIVYPNYNSPTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHI
APGETTRCEFRSGQDVELWPLEIAEARLSSVPPDMPNLEKHRIAYHRLKGALRIKLKLVG
DLTFSQLEGLDRLPIYIDGDERIVSHIFELLHASHVATIIRAGHGETAKDTVISDQPLSF
EGLSPDQSLLPLSWNIFHGHNLVQEYFTCRQRFYFFTLTQLSQSLRDNHTGEAEIIILLD
RLPQDLVSHVAPSRFLLACTPVINLFPKRMDKIEINRALNDFHVVPDRSRPLDYEVFAIN
KVFGQQAETSNEVVFNPLYQTRHCDNGNFGRYFSITRKARTGDSNKRKYDTRTPYASTEV
FVSLVDQQEAPYGDSLRYLSIEAQVTNRDLPRLISASGNFELTMSDSAPVHGARFVFQPS
APRAPFAMDESAWRLIRQLSFNYLPLSDMSHSNGGESLRNMLRLFVNASDHESNTQIDAL
VGCKSEPVIRRLPGNGLLVYGRGICCTLTVDEEGFSGISPYLFGMIMENYVARHAAINVF
TETELNSMQRGRVGHWKARPGRRGVL
NT seq 1881 nt   +upstreamnt  +downstreamnt
gtggatcacaaatttcttgactattacaataaagaactcacttttatgcgcgagatggcg
caagagtttgctgaaaaacatcccaaaatagcaggccgcctgggcatgcatgggattgaa
gtcgccgacccttacgttgagcggctgatagagtccttctgttttttatctgccagaacg
cagattaagttggatgctgagtttcctaaatttactcagcgtcttttggacattgtctat
cccaattacaattcgccaaccccctcaatgggcgtgatccaacttaagccaaatctgaag
gaaggagatttgactcaagggtattgtgttcccaggggcagctcgttcttcacccatatc
gcacctggcgagacaacccgctgcgagttccgcagtggtcaggatgtggagttgtggcca
ctggaaatagcagaagcgcgtctaagctctgttcccccggatatgcctaatctggaaaag
caccgcattgcctatcatcggcttaaaggtgccttacgcattaaattaaaattagtgggc
gatctcactttctcacaattagaaggccttgatcggctgcctatttatattgatggtgat
gaacgaatcgtttcacatatcttcgagctactccacgccagccatgttgctaccatcata
cgggcaggccacggagagacagcaaaagacaccgtgatcagtgatcagccactgtccttt
gaagggctaagccccgaccaaagcctactgccgctatcatggaatatctttcacggacat
aatctggtgcaggaatactttacctgccgccagcgtttctacttttttacgctgacacag
ctgtcgcaaagtttgcgcgataatcataccggtgaagcggaaatcatcatcctactggac
agattaccgcaggatttggtgagccatgttgccccctctcgcttcctgttagcctgcacg
ccagtgattaatctctttcctaaacgcatggataagatcgaaattaaccgtgcactgaac
gattttcacgtagtaccagaccgtagccgcccactggattatgaggttttcgccattaat
aaagtgtttggtcaacaggcggaaaccagcaacgaggtggtatttaacccactttatcaa
acccgtcactgtgataatggcaactttgggcgttatttctccatcacccgcaaggccaga
acgggcgatagcaacaaaagaaaatatgacacccgcacgccttacgccagtaccgaggtc
tttgtctcgttggtcgatcaacaagaggctccttatggcgatagcttgcgctacctctct
attgaagctcaggtgactaatcgggatcttccgcgcctgatttccgccagtggtaatttt
gaattgaccatgtcggattcagcgcccgttcacggtgcccggtttgtcttccaacccagc
gccccacgcgccccctttgccatggatgaatccgcctggcgtttgattcgccaattgagc
ttcaactatctgccactgtcagatatgtcccactcgaatgggggggagtcactgcgcaat
atgctacgtctgtttgttaacgcttcagaccatgaatcgaatacacaaattgacgcgctg
gtgggctgtaaaagcgagccggtgatccgccggttacccggcaatggcctactggtttat
ggccggggcatctgctgcactttgaccgtggatgaagaaggattctccggtatcagccct
tatctatttggcatgatcatggaaaattatgtggcccgccatgccgcaataaatgtgttt
accgagaccgagctaaactccatgcaaagaggacgtgtcggtcattggaaagcccgccct
ggcagacgaggagtcctgtaa

DBGET integrated database retrieval system